SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006747 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006747
Domain Number 1 Region: 2-301
Classification Level Classification E-value
Superfamily Cytochrome P450 1.26e-80
Family Cytochrome P450 0.00000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006747   Gene: ENSMODG00000005459   Transcript: ENSMODT00000006885
Sequence length 311
Comment pep:novel chromosome:BROADO5:1:76668644:76680079:-1 gene:ENSMODG00000005459 transcript:ENSMODT00000006885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRNFGMGKKSIEENVQEEAKLLVEAIKQTKGLPCDPTFILGCAPCNVICSLIFQKHFE
YKDPKFLYLMKLLDDDLKLLSSPWIQVYNYFSPLIHYLPGLHHKLFKITDLQKKFILEEV
KEHQQTLDPNNIRDFIDCFLMKMEQEKQKPLSEFTIGNLVNTAIDLFAAGTETTSTTLKY
GFLMLLKHPEITEKIHEEIDRVIGYNRSPCMEDRNKVPYTNAVVHEIQRYIDHIPTSLPH
AVTEDVQFRQYLIPKGTTIIPLLTSVLYDDEEFPNPHQFDPGHFLDASGNFKKSDYFMPF
STAFKPWKPSR
Download sequence
Identical sequences F7CGP7
ENSMODP00000006747 ENSMODP00000006747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]