SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006838 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006838
Domain Number 1 Region: 253-324
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 193-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 313-372
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 140-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000278
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 5 Region: 89-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006838
Domain Number - Region: 614-656
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0584
Family Fibronectin type III 0.0098
Further Details:      
 
Domain Number - Region: 57-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006838   Gene: ENSMODG00000005525   Transcript: ENSMODT00000006976
Sequence length 818
Comment pep:novel chromosome:BROADO5:6:53588259:53972192:1 gene:ENSMODG00000005525 transcript:ENSMODT00000006976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVREGRDPWRGVCSNGPVPMLQGQQGRLLLLLQLLLVQLLRPPSRALGAPVSDVCATCHE
HATCQQRDGKEICICNYGFVGNGRTQCHDKDECQFGATLVCGNKTSCHNTHGGFYCICLE
GYRATNNNKTFIPNDGTFCTDLDECEEPDACGPGGQCVNTPGSYECYCKEGYLLPNGTQP
FHPPRDGTSCTEIDCGTPPEIPNGYIIGKYTSRLGGRVHYACKDGFHSEEQESVTSCTAA
GTWDTSKIHCQAVDCGILPSFPNAYPALQSNTTYGSRVVYKCQKGYVPETSNHVVFCNAQ
GQWEGPSLMCREIECGSPPVIQHAILVGNYSSAVGSLVYYTCVDGFESTGGHLSSLCTAE
GTWTKTAFHCTETKPSISNVSVFNDTCLKWRTSPGRVASKMVYLIHIQGQEEGETELVHE
DLLNLTTSSQEPEVCLHLSQGTNYTVTIRMTFPKLSVPVTVSIQTADDDGSFDVSVFNET
CLKWKRRSRGTVEEQIYQFQVLGRRWYQNNFYHSASFNFTTRERYPEVCLDLYPRTCYTV
NITTVAFPKHLAHIIITTPKSGKQIISNISVFNETCMRWKRNEKMDDDSEEMYLFHIWGH
RGYQKEFEQEVSFNLTTGSQAPEVCLELYPGTNYTVNITAASSGLPVLVSLMTQITEPPI
PEIEFVAVHGGPLPPLSLWKAEDRNGPISSYQVLVLPLALRSTFPCDSIQDTTFFSNDSS
TSGYVAAEFLAKDVSDVREIFLGDRLYYGKFYNAPLKPRNDYCIIVRIISKWNQVRRQSC
VVWAEVKDSSLTLAQMMGVGFGSVAVVVILVLLSFSIV
Download sequence
Identical sequences F7FV45
ENSMODP00000006838 XP_007498227.1.35504 ENSMODP00000006838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]