SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006883 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006883
Domain Number 1 Region: 2-363
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-101
Family L-arabinose binding protein-like 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006883
Domain Number - Region: 534-741
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000144
Family Calcium ATPase, transmembrane domain M 0.024
Further Details:      
 
Domain Number - Region: 438-486
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00659
Family TNF receptor-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006883   Gene: ENSMODG00000005567   Transcript: ENSMODT00000007023
Sequence length 774
Comment pep:novel chromosome:BROADO5:4:399054281:399068375:1 gene:ENSMODG00000005567 transcript:ENSMODT00000007023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYQVLALMLAVEEINMNSKLLPNITLGFHIFNAYHNDERTLESSLVWLSGQGQNIPNYSC
ERQGKSTVVIGGATSELTVAMGSLLELYRFPQVTYGLFDPLLSDPVQFPSVYQMAPRDTS
LPLAMVRLMVHFKWTWVGLVASDDSRSEKFLRDLQEEMVRNDVCVAFIHKSSPSLTKDKY
DCSYFLKKLSSSTATVIVIYGNTDTLLTLRFRDVPYTLLYRMWITSSHWDIVKKPGYVHF
DNFHGALIFADQTSKIPGFKHFLKTIHPAKDPENIFLWNFWNSAFGCAPKIGKGDGAVCT
PNASLDTLRLSYVDLTMSDQSYTVYNAVYAVAWALHEMFLVRSEMESNRNGNNSGIYPWQ
VINSSDLHTFQRKGCDHQHFMLHASISLRKSKPAIFPFPGSLSYSRALWYNRWSLCFEVR
KPGPQTSSEIVFRSLQIPLPSRCDKVCSPGFHIKTQEGKPVCCFDCAPCPQGQISKQTDR
DQCMKCPVDHYPNRERIHCLPKSVTFLAYEETLGMALASIAASFSLLTALVLWVFVKHKD
TPIVKANNRDLSYILLLSLSLCFLCSLFFIGRPTTTNCLLRQTTFGVTFTVAVSSILAKT
ITVVWAFRATRPGRRSRRWVGSRGPISLVVFCTFIQVTLCTIWLFLSPPFPDADTHSDPE
HIILECNEGSLIAFYSVLGYIALLALGSFTVAFLARNLPDTFNEAKFITFSMLVFCSVWI
SFLPTYQSTKGKMMVAVEVFSILSSSAGLLGCIFIPKCYVILVQPQMNTKKFLK
Download sequence
Identical sequences F7F3N4
13616.ENSMODP00000006883 ENSMODP00000006883 ENSMODP00000006883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]