SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006887 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006887
Domain Number 1 Region: 51-367
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.77e-100
Family Glycosyl hydrolases family 35 catalytic domain 0.0000434
Further Details:      
 
Domain Number 2 Region: 485-625
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.22e-27
Family Beta-galactosidase LacA, domains 4 and 5 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006887   Gene: ENSMODG00000005565   Transcript: ENSMODT00000007027
Sequence length 636
Comment pep:novel chromosome:BROADO5:4:286575331:286649265:1 gene:ENSMODG00000005565 transcript:ENSMODT00000007027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTTSGRRREQRRKLGLLLLVIVGCLVVRRFNWSNMVPIQRWNRHLGLQAKDSEFLLEGS
RFRIFGGSIHYFRVPREYWKDRLLKLKACGLNTLTTYIPWNLHEPERGKFNFSGNLDVEA
FVQMAADIGLWVILRPGPYICSEWDLGGLPSWLLQDSSMELRTTYVGFIKAVDLYFNQLI
PRVVPLQYTQGGPIIAVQVENEYGSYDKDPNYMPYIKMALLKRGIVELLMTSDNKDGLSG
GYVEGVLATINLKNVDSIIFNYLQSFQDNKPTMVTEFWTGWFDTWGGPHHIVDADDVMVS
VSSIIQMGASLNLYMFHGGTNFGFMNGAQHFTDYQADVTSYDYDAILTEAGDYTPKFFKL
REYFSTLIDNPLPQLPALKPKASYHAVRPSHYISLWDALEHMDKPIESEKPVNMENLSVN
QGNGQSYGYILYETSIYEGGTLFSKDHIRDRAQVFVNKIYIGYIDYLVEGLTIPRGQGHR
KLSILVENCGRVNYGLMLNKQRKGLIGDIYLNDSPLRNFKIYSLEMKADFFQRLSSTWSP
VPEEATGPAFFRGTLHVGFIVLDTFLKLEGWVKGVVFINGQNLGRFWSIGPQETLYLPGP
WLHPGENEIIVFEEQKSGMIIQSMDTPYLGRSHYVD
Download sequence
Identical sequences F7F3M1
XP_007495231.1.35504 ENSMODP00000006887 ENSMODP00000006887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]