SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006952 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006952
Domain Number 1 Region: 80-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-44
Family SPRY domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006952   Gene: ENSMODG00000005615   Transcript: ENSMODT00000007092
Sequence length 614
Comment pep:novel chromosome:BROADO5:1:685489602:685636686:-1 gene:ENSMODG00000005615 transcript:ENSMODT00000007092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAHSLLAGRDGSGACLPPPLCDTIAAPSKMAAAAADPGAGSPPAGESCGGGGSSTGGLPS
PGEQELTRRLQRLYPAVNQHETPLPRSWSPKDKYNYIGLSQSNLRVHYKGHGKNHKDAAS
VRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHS
FCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPANLYPTVGLQTP
GEIVDANFGQQPFVFDIEDYMREWRAKIQGTIKRFPIGDRLGEWQAMLQNMVSSYLVHHG
YCATATAFARMTETTIQEEQASIKNRQRIQKLMLAGRVGEAIEATQQLYPGLLEHNPNLL
FMLKCRQFVEMVNGTDSEVRCFSARSPKSQDSYPGSPSLSPRHGPSNSHLHSTGAESPSC
SNGVTSTKSKQSHSKYPALSSSSSSSSSSSPSSVNYSESNSTDSTKSQQHSSTSNQETSD
SEMEMEAEHYPNGVLENSSTRIMNGAYKHEEILQTDESSMEDGRPRRQLCGGNQAATERI
ILFGRELQTLSEQLCREYGKNLAHKEMLQDAFSLLAYSDPWNCPVGQQLDPIQREPVCAA
LNSAILGRKRVPRQ
Download sequence
Identical sequences F7CZC7
ENSMODP00000006952 13616.ENSMODP00000006952 ENSMODP00000006952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]