SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006974 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006974
Domain Number 1 Region: 336-504,668-805
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-38
Family Tandem AAA-ATPase domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006974
Domain Number - Region: 282-333,412-433
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000885
Family Tandem AAA-ATPase domain 0.018
Further Details:      
 
Domain Number - Region: 116-196
Classification Level Classification E-value
Superfamily DEATH domain 0.00141
Family Caspase recruitment domain, CARD 0.031
Further Details:      
 
Domain Number - Region: 8-90
Classification Level Classification E-value
Superfamily DEATH domain 0.0124
Family Caspase recruitment domain, CARD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006974   Gene: ENSMODG00000005628   Transcript: ENSMODT00000007114
Sequence length 997
Comment pep:novel chromosome:BROADO5:4:168316865:168417960:-1 gene:ENSMODG00000005628 transcript:ENSMODT00000007114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFESSQEKNFLNLIQCFRPRLKQYIRVEPVLDYLTFLDREKKEHIRQTAATQGNAVAAE
FLLSTLEKGTWGPGWAQEFLTGLNHGGCTLAARYMNPDLADLPSPSLETCYDQCVQLLDI
LQPTLVDKLQATAVVDKCLEKALLTKEDTNRVINLNENYGNEHAVRELLNRIVQKEDWFS
KFLSILRETEHIKLAEDFIAVDYLEDNEDQQQEENDILSVESDELESSFAGSSVVSESDT
SLAEGSVSCLDESLGHNSNMGSVSGTMGSDSDQDDEKKRASPEPELVLRSYQMEVAEPAL
EGKNIIIIIPTGSGKTRVAVYIAKDHLDKKKKASEPGKVMVLVNKVPLVDQHLRKEFNPF
LKKCYRVIGVSGDSQLKISFPEVVRSYDVIISTAQILENSLLDSENGDDDGVQLSDFSLI
IIDECHHTNKEAVYNTIMRRYVKQKMKNCRLKKANKPVVPQPQILGLTASPGVGGATKQA
KAEDHILQLCANLDASMIVTVKENASFLKEQVKEPCKKFVIAADNRENPFKKKLVEIMTN
IQNFCQMNPTSDLGTQSYEQFVIQKEKRAAKEGNCKERVCAEHLRKYNEALQINDTIRML
DAYQHLESFYNDEKEKKMATQEYDQEEDDNEKKALKVDETDTFLLDLFYENKKELKKLAM
TPDYENEKLTKLRNTIMEEFTKTDGSVARGIIFTKTRQSAYSLSQWINSIEKFAEVGVKA
HHLIGAGNSSEFKAMTQNEQKEVINNFRTGKINLLIATTVAEEGLDIKECNIVIRYSLVT
NEIAMLQARGRARADESTYVLVASDGSGVVERENVNLYREKMMHKAIERVQNMKPEEYAQ
KIWGLQKQSLMEKKMKTRKSLAKQIKDKPSLVTFHCKKCNVQACSGEDIQVIENMHHVIM
TQEFKSFYIVRENKALQKKFADYQTNGEIICSQCGQSWGTMMVNKGLDLPCLKIRNFVVD
FKNNSEKKQYKKWVELPIAFPKLDYAEHCMFSDEDEY
Download sequence
Identical sequences F7CF07
XP_007494333.1.35504 ENSMODP00000006974 ENSMODP00000006974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]