SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006984 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006984
Domain Number 1 Region: 447-835
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-131
Family Ankyrin repeat 0.000000000359
Further Details:      
 
Domain Number 2 Region: 210-468
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.23e-73
Family Ankyrin repeat 0.00000615
Further Details:      
 
Domain Number 3 Region: 45-310
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-55
Family Ankyrin repeat 0.00000768
Further Details:      
 
Domain Number 4 Region: 1462-1574
Classification Level Classification E-value
Superfamily DEATH domain 1.85e-26
Family DEATH domain, DD 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006984
Domain Number - Region: 1807-1877
Classification Level Classification E-value
Superfamily DNA-binding protein Tfx 0.00785
Family DNA-binding protein Tfx 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006984   Gene: ENSMODG00000005638   Transcript: ENSMODT00000007124
Sequence length 1910
Comment pep:novel chromosome:BROADO5:5:66598683:66944492:1 gene:ENSMODG00000005638 transcript:ENSMODT00000007124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAAASIKKVREAELDEKEKNLERERKKQRKIPRERIERKRKSDSNASFLRAARAGNLD
KVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSAVDSATKKGNTALHIAS
LAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFT
PLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMM
VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLL
LDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHV
ECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIA
CKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGE
TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA
ATKNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLFQR
RASPDSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIA
TTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGSNIHMSTKSGLTSLHLAAQE
DKVNVAEILTKHGANKDAQTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPL
HQAAQQGHTHIINVLLQHGAKPNAITANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTT
TVTEKHKLNVPETMTEVLDVSDEEGEDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMS
YLRYSLEGGRSDSNIPSSDRSHTLSHASYLRDSAMIDETVVIPSHQVSTLAKEAERTSYR
LSWGTDHLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTC
RLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVILRS
ENGDSWKEHYCEYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQ
DSNLIGPEGGVLSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELIRKILGNKATFSPI
VTLEPRRRKFHKPITMTIPVPKASSDGMLNGFGGDTPTLRLLCSITGGTTPAQWEDITGT
TPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSQDP
IEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHH
IFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPLYTKES
ESDQEQEEEIDMTSEKNLQDEQERIEERLAHIADHLGFSWTELARELDFTEEQIHQIRIE
NPNSLQDQSHALLKYWLERDGKHATDNSLTECLTKINRMDIVHLMETSTMEPLQERTSRS
YAEIEQTIALDHSEGFSVLQEEMCTPQHKKGEQAVSKEQEPSSDHPPIVSEEDISVGYSS
FQDGIPKTEGDLTVEELTQQTHKEGVQTEFSGKFEDLIQESSVDHQQEYFVTTPGTEQEE
ARKVVQVSGSLSKTPEEITATSEEERLCLQTPTASDQGESPIVQEPEEFPLNQEASSPRR
SSLVIVESADDQPQKFEKFEEESFEKGDDMPEIPSETVTEEEYTDEHGHTVVKKVTRKVI
RRYISPEGIEKEDVTMCGTLQEPVNIEEGDGYSKVIKRVVLKSDSEQSEVTFSEPSASHF
QSEPVEGRKVSKVVKTTVVHGERMEKHLGDASLATDLPSAKDDFEEDNNE
Download sequence
Identical sequences F7BWR0
ENSMODP00000006984 ENSMODP00000006984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]