SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007049 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007049
Domain Number 1 Region: 128-394
Classification Level Classification E-value
Superfamily vWA-like 2.29e-90
Family Trunk domain of Sec23/24 0.000000657
Further Details:      
 
Domain Number 2 Region: 8-66,411-519
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.75e-63
Family beta-sandwich domain of Sec23/24 0.00039
Further Details:      
 
Domain Number 3 Region: 623-763
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 9.68e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.0000065
Further Details:      
 
Domain Number 4 Region: 520-622
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 3.4e-46
Family Helical domain of Sec23/24 0.00000779
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.09e-21
Family Zn-finger domain of Sec23/24 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007049   Gene: ENSMODG00000005687   Transcript: ENSMODT00000007190
Sequence length 767
Comment pep:novel chromosome:BROADO5:1:604276875:604306279:-1 gene:ENSMODG00000005687 transcript:ENSMODT00000007190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEMNQPAELMPQFSTIEYI
VQRGPQTPLIFLYVVDTCLEEEDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPAQQTRPVQPQGQPFISSRFLQPVHKIDM
NLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP
GMVVGDELKVPIRSWHDIEKDNARFMKKATKHYEMLANRTATNGHCIDIYACALDQTGLL
EMKCCANLTGGHMVMGDSFNTSLFKQTFQRVFSKDFNGDFRMAFGATLDVKTSRELKISG
AIGPCISLNVKGPCVSENEYGISGTSQWKICSLDPTSTLGIYFEVVNQHNAPIPQGGRGA
IQFVTQYQHSSTQRRIRVTTVARNWADAQNQLQHIEAAFDQEAAAVLMARLGVFRAESEE
GPDVLRWLDRQLIRLCQKFGQYNKEDPNSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQDILQTRFPMPRYINTEHGGSQARFL
LSKVNPSQTHNNLYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAS
Download sequence
Identical sequences F6V3D4
13616.ENSMODP00000007049 XP_001374135.1.35504 XP_007476706.1.35504 ENSMODP00000007049 ENSMODP00000007049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]