SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007157 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007157
Domain Number 1 Region: 960-1174
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-103
Family Thrombospondin C-terminal domain 0.00000000508
Further Details:      
 
Domain Number 2 Region: 31-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.29e-38
Family Laminin G-like module 0.0000182
Further Details:      
 
Domain Number 3 Region: 837-959
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.31e-36
Family TSP type-3 repeat 0.000000507
Further Details:      
 
Domain Number 4 Region: 768-839
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.89e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 496-547
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.18e-16
Family TSP-1 type 1 repeat 0.0000809
Further Details:      
 
Domain Number 6 Region: 439-494
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000129
Family TSP-1 type 1 repeat 0.000096
Further Details:      
 
Domain Number 7 Region: 696-780
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000157
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 321-379
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000555
Family VWC domain 0.0054
Further Details:      
 
Domain Number 9 Region: 385-428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 10 Region: 552-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000323
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007157   Gene: ENSMODG00000005780   Transcript: ENSMODT00000007303
Sequence length 1175
Comment pep:novel chromosome:BROADO5:2:454662220:454709926:-1 gene:ENSMODG00000005780 transcript:ENSMODT00000007303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQGGRMLWWLVLLALWVFSSAQDGDAEDDTSFDLFEISNINRRTVGAKQFRGPDPTSPA
YRFIRFDHIPPVKAEILKKMIKMMRQNEGFFLTATLKQDKHSRGTLLALEGPGNSQRQFE
IISNGRANTLDLIYSGDKGQNVISLEDVDLADSHWKNITVQLTGETYGLYVGCDLIDSFI
LEEPFFEQLKAENSKMYVAKGSIRENHFRGFLQDVRLVFETSVEDVLIKRGCQRSQTAEM
NTINESTEILRLSSTEYVGPNTEKNAEVCERSCEELGSMINEISGLRSLVNTLTERLTKV
TNDNQVLWELVGVPLKVRNQTACWQDGRFFQDNETWVVDSCTKCTCKKFKTVCHQITCPA
VACANPIFVEGECCPSCSPFNDNEEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLG
PSIQTRMCSLGKCDNRIRQDGGWSHWSPWSSCSVTCGLGNITRIRLCNSPVPQLGGKNCK
GSGRETKECEKAPCPINGRWSPWSPWSACSVTCAGGIRERSRVCNNPEPQYGGKDCVGDV
KEHQMCNRRSCPIDGCLSNPCFPGAECNSFPDGSWSCGSCPVGYLGNGTHCEDLDECTVV
TDVCFISNKVHRCVNTNPGFHCLPCPPRYKGTQPFAVGLEAARTEKQVCEPENPCKDKTH
NCHKHSECIYLGHFSDPMYKCECKTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIK
DNCPHLPNSGQEDFDKDGIGDACDTDDDNDGVDDEKDNCPLLFNPRQSDYDKDEVGDRCD
NCPYVHNLAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDN
CPLMHNPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDNDGKGDACD
SDDDNDGIPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAISET
DFRKFQMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVN
TDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWENQPTRAYGYSGVSLKVVNSTTGTGEH
LRNALWHTGNTEGQVRTLWHDPKNVGWKDYTAYRWHLTHRPKTGYMRVLVHEGKQVMADS
GPIYDQTYAGGRLGLFVFSQEMVFFSDLKYECRDV
Download sequence
Identical sequences F6XY15
ENSMODP00000007157 ENSMODP00000007157 XP_007484981.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]