SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007235 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007235
Domain Number 1 Region: 820-945
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000157
Family PBS lyase HEAT-like repeat 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007235
Domain Number - Region: 73-146
Classification Level Classification E-value
Superfamily HR1 repeat 0.00458
Family HR1 repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007235   Gene: ENSMODG00000005845   Transcript: ENSMODT00000007383
Sequence length 974
Comment pep:novel chromosome:BROADO5:1:685211588:685224389:1 gene:ENSMODG00000005845 transcript:ENSMODT00000007383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPKVPQPERLDQVYEALKRGLTAYLEVHQLEQEKLQVQIRESKRNSRLGFLYELDKQVKS
IERFLRRLEFHASKIDELYDGYCIQRRLRDGAHNMVRAYTSGTPGSREARDSLAEATRGH
REYTESMCLLESEIEGQLGEFHLKMKGLAGFARLCVGDQYEIYMKYGRQRWKLRGRIEGS
GKQVWDSEDMVFLPLLTEFLSIKVTELKSLANHVVVGSVSCETKDLFAALPQVVAVDIND
LGTIKLSLEVTWSPFDKDDQPSAASTVTKTSTVSKRFSTYSQSPPDTPSLREQAFYRRKG
PKSHHAQGLTASAHIVRGLTSSVHPDSSPPSTPDVQPDPLSPSPILSCLDSTTLHAGLTP
STSEPVTLNQNSLPSHPRSSDSDFPHPDPIPSQPDSTPSHPEPAPSPSDPAPLTPANSPK
STNHATPCPGLALLHSDPVPPHSDSSSPHSYPNSSHTEPTPPTTTQLPLTDHTPSPPVVP
QVPVQEAAGMPLMEAKAPPQTGQPEQGTGLRDTGLEEALVALSSALDDCRGQFPELQGLE
QEVTRLESLLMQRQGMSRSRASSLSLTVEHALESFSFLNEDEDEDDGPEDRNVEGESKGK
ESFSSLESSSHPLVVPHSPGPGSEAGVSCVSEDALDSSTPGPLSTGCPALDTALVSHLQH
CGHLLLKLGTFGPLRCQEASALERLLREALVLEVVCQLCGGQVGKATSAQEVLQFSVPRP
GFLPFWDQCTEGGNLLVCPVERILFTFCSQYGARLSLRQPGLAEAVCVKFLEDAMGQRLP
RRPRPGPGEQLTIFQYWSYIEALNSPSMEAYVTETAEEVLLVKNLNSDDQAVVLRALRLA
PEGRLHRDGLRALSSLLIHGNSKVMAAVTAQLRSLALGSEFRKKALLCFLEQLEDEDIQI
RVAGCVALGCLKAPEGIEPLVYLCQTDKEEVREAARQSLLQCGEDGQSAHRRLEESLEAL
PRIFGPGSMASTAF
Download sequence
Identical sequences F6TL03
ENSMODP00000007235 ENSMODP00000007235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]