SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007296 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000007296
Domain Number - Region: 264-362
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0942
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007296   Gene: ENSMODG00000005895   Transcript: ENSMODT00000007444
Sequence length 393
Comment pep:novel chromosome:BROADO5:1:247574390:247575648:-1 gene:ENSMODG00000005895 transcript:ENSMODT00000007444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYLPNAHLEYHYTLTQYIHPYPKDWVSIFKVGWSTARDYYTFLWSPMPEHYVEGATVNYL
LSFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFSASSPVEELLTMEDEGNSDMLVVT
TKAGLLEFKIEKTMKEKEELLKVTTVWKRRLLSLKNRLEDWKKELNHEKERCDQLQVECK
GLLEENLMTVTQRAITKETDLDSLKDKLKKVTLEKEQLECQLKTEKDEKELYKVHLKNTE
IENTKIVTEIQTLKNLDGNKETMIAHYKEEVGRLQLCVAEKENLQRAFLLTTSDKDDAAN
LKEQLCKAEEQVQATWQEVVFLAKELSDAVNMRDQTMADLHSTGLENEQVKKQLAETVAE
LSVTVVKKQQEKTDPVEQDLRREVEDLKLHLQM
Download sequence
Identical sequences F6S519
13616.ENSMODP00000007296 ENSMODP00000007296 ENSMODP00000007296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]