SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007348 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000007348
Domain Number - Region: 122-172
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0863
Family AN1-like Zinc finger 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007348   Gene: ENSMODG00000005943   Transcript: ENSMODT00000007497
Sequence length 490
Comment pep:novel chromosome:BROADO5:1:684669271:684718353:-1 gene:ENSMODG00000005943 transcript:ENSMODT00000007497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNICNKPSNKTAPEKPEWTASNKDSGPSPELCGQRSRRNGWSWPPHPFQIVAWLLYLFFA
LIGFGILVPLLPHPWVPAGYACMGIVFVCHLVVHLTAVSIDPADANVRDKSYAGPLPIFN
RSQHAHVIEDLHCNLCDVDVSSRSKHCSACNKCVCGFDHHCKWLNNCVGERNYWLFLNSV
VSALLGVLLLVLIAFYIFVEFFINPMRLRTNKHFEVLKNHTDVWFVFLPAAPVETQAPAI
LALAALLILLGLLSVVLLGHLLCFHIYLMWHKLTTYEYIVQQRPSKEVKETQKELKSCPA
KMRPIQEVEFYVRSFSYTNSELQAEGLSTHLLPSAPSRSTLFVTSSEPVLPSSADSPVLL
PKNQPQKKKKRKVYKVPALVATDKSQGRVPPRPRLPAPCPGKFSLPWALTQGPNPAHPSG
PPADYHSESAESMEEIPVAQTRLGTPSLGKRCPQGKDYEQELEFMTKVPTVFVSQSSGDP
PGPSRGQQCT
Download sequence
Identical sequences F6WW01
ENSMODP00000007348 13616.ENSMODP00000007348 ENSMODP00000007348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]