SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007359 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007359
Domain Number 1 Region: 32-483
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.65e-96
Family L-arabinose binding protein-like 0.0000196
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007359
Domain Number - Region: 490-542
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0589
Family TNF receptor-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007359   Gene: ENSMODG00000005985   Transcript: ENSMODT00000007508
Sequence length 842
Comment pep:novel chromosome:BROADO5:4:394840704:394863063:1 gene:ENSMODG00000005985 transcript:ENSMODT00000007508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFKPYLVYLTLFMTCLFNCQETETHSDFKMPGDHTIAGLFPIHSVDDEVRLRPEVTLC
GRSKTFNGHGYHLFQAMRFGIEEINNSSSLLPNVTLGYELYDVCSKSSNVYATLSVLSQP
RGNHIRFPENVFNYYPKAVAVIGPDSTELTSISASLLSTFLVPQISYEATSMMFSEKQKY
PSFLRTIPSDKHQVQMILMLLKKFGWSWISVIGSENDYGLQGVHLLEDLANQQEICIAYK
DFVPILAQAADNTMQNMMVDINKFGAEVVVVFCNKRLARVFFEAVVLGNVTDKVWLATED
WSISSYITQVPGISRIGTVIGIAIKQRQVLGMKEFEEAYAQAKNTSEASGGPAQDRGDHT
CNQHQALTANANTELSQFSMNAAYNVYAAVYAVAHGLHQLLGCPSGVCTPGKIYPWQLLA
EIRKVNFTLQGNPVSFDEDGDPVSGYDIITWDWNGPNWTFKVIGTSTWYPVFLEIDGTKI
HWHREENQVPRSVCSQDCLPGEARRIVGLHHCCFECVLCAAGTFLNSSGFFFLPDQYTCQ
PCQKEEWSPEGSQTCFNRTTEFLAWDHPVSLVLLGANTLLLLLLTGVASLFAQNLETPVV
RSAGGRMCFLMLGSLAGAGCSPYCFLGEPTLLTCLLRQSLFALCFAVFLSCLTIRSFQLV
FIFKLSAKMPALYHTWVHNHGSRTFVAVSSTIQLLICSVWLVAWTPLPIKEYKRFPELVV
LECSKENSPGYMLSILYTWLLSVSCFACTYLGKDLPENYNEAKCMTFSLLFYFISWIGLA
TSSSIYNGKYMPAINMLVILSSLSGVFSGYFLPKCYVILCRPDLNTTEYFQASIQDYTQR
CS
Download sequence
Identical sequences F6SLE6
ENSMODP00000007359 ENSMODP00000007404 13616.ENSMODP00000007404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]