SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007649 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007649
Domain Number 1 Region: 8-488
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.68e-94
Family L-arabinose binding protein-like 0.0000513
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007649
Domain Number - Region: 488-534
Classification Level Classification E-value
Superfamily TNF receptor-like 0.04
Family TNF receptor-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007649   Gene: ENSMODG00000006176   Transcript: ENSMODT00000007804
Sequence length 832
Comment pep:novel chromosome:BROADO5:4:398130323:398145460:1 gene:ENSMODG00000006176 transcript:ENSMODT00000007804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQKYERMGDVLIGGSFPIFSTNFSSGDFTSPPARGNSTGFSSWGSSTFLGFVFAIEEINR
DVHLLPNLTLGFSIWDSGNSVDEALLGTMDFLAGQGNPVPNYSCRTQLPLTALVGELRSA
LSVPIARWLGLYKFPQISYGSSIVSLSDKTHFPSFLRTVPNDQVWFQGVTILLDHFGWIW
VGIVSSDDDYGNQGSSLMRDELEKFGICQEFLIVFPAFHFPEEFQQNQSLFQKSTAKVII
AILSNAYYLQFLHFFSPNDISGKIWIRNHVLIGNPWNGWMRYNSDFPQTISVSLTQPTIQ
GFPEFSRHLHPHSTSEDIFMNLEGGNVFNCTWQGQDTSSLGNRIEPGGDQLCTVSEHRQD
KDILSFSLGKLSITYSAYKAVYSIAHALQDLSSCEEGEEPTGNKMCPDIKTFRPWQLLQY
IRKVHFQMPQNIEVFFDANGDIPSVYNILNVQKNSEGFFDLITVGYVDSTAPCGIEIVVN
ESAIQWKGGKTQVPQSVCRESCPPGSSQIFTKGWSRCCFDCELCPEGHFADHRDMQQCVK
CPEDQYANTHRDGCLPKVVTFLAYEELLGIVVTCMALAFSLLTGLVFMIFMKHRDTPIVK
ANNRALSYTLLLSLTFCFLCSLLFVGRPTTVSCLLQQVTFGITFTVAISSVLAKTITVVL
AFKAIRPGSWLRRWASTRVSNIIVLICSLIQVTLCGVWIATSPPFVDMVTDFDPSYILLV
CNEGSIITFYSVLGYMGFLALGSFTVAFLSRNLPDTFNETKFITFSMLVFCSVWFPFLPA
YQYTKGKIMVAMEAFAILASSAGLLICIFVPKCYVILWKPHQNTQAWLKGQH
Download sequence
Identical sequences F7B5F0
ENSMODP00000007649 13616.ENSMODP00000007649 ENSMODP00000007649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]