SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007693 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007693
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000104
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007693   Gene: ENSMODG00000006210   Transcript: ENSMODT00000007848
Sequence length 221
Comment pep:novel chromosome:BROADO5:1:684380526:684382991:1 gene:ENSMODG00000006210 transcript:ENSMODT00000007848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNIQERPSELIQRERRRLVDTLKNDSRILLDGLFARGVIFVNEYESLDAMDDPERMVRK
ILLIVQQKGEFACQELLKCASEIHPNDSRDPYWNWKLTPEGKQGVSHDSCWEGDRSTEYS
AGGMCIGIPNPGEEDKPDDNEGQEILEVTEKDVPEDQETPKDPEPGSKAPENVELVEEPE
NDDFPGWDVEPESEQGDVEDEYEGATVVEGRSKGEIQREEE
Download sequence
Identical sequences F6ZSV6
ENSMODP00000007693 ENSMODP00000007693 13616.ENSMODP00000007693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]