SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007725 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007725
Domain Number 1 Region: 59-119
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.88e-16
Family AN1-like Zinc finger 0.00011
Further Details:      
 
Domain Number 2 Region: 6-53
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000000641
Family AN1-like Zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007725   Gene: ENSMODG00000006232   Transcript: ENSMODT00000007880
Sequence length 254
Comment pep:novel chromosome:BROADO5:3:151576899:151612084:1 gene:ENSMODG00000006232 transcript:ENSMODT00000007880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELDIGQHCQVEHCRQKDFLPFVCDGCSGIFCLEHRSRESHGCSEVNIKNERLKTDDHS
SYPCSYKDCSGRELVPVLCPFCEKNFCLRHRHQSDHECEKLKGPQARMAATKQLVKEIID
SKKGAAINKGRRGAKNSETAAKVALMKLKMHADGDKSLPQTERIYFQVFLPKGSKEKSKP
MFFCCKWSIGKVVDFAASLSNLKNENNKATAKKLRLCNIATGEALPSDQTLETWIAKEDC
PLYNGEEEEERRDS
Download sequence
Identical sequences F7FS52
ENSMODP00000007725 ENSMODP00000007725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]