SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007741 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007741
Domain Number 1 Region: 5-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 3.53e-65
Family TRADD, N-terminal domain 0.00000196
Further Details:      
 
Domain Number 2 Region: 224-305
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000589
Family DEATH domain, DD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007741   Gene: ENSMODG00000006242   Transcript: ENSMODT00000007896
Sequence length 316
Comment pep:novel chromosome:BROADO5:1:684332824:684336914:-1 gene:ENSMODG00000006242 transcript:ENSMODT00000007896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGHQEWSGGAYLFVESTMEKVILSDLYQDPQKKLAVFRALKMALAECSGSQDGAQILK
IHCSGLQLIVQLKFCGQELCGRFLRSYREGALRDALRNSLVPLLDQAQHLGQLHLELHVG
SERLDLMLHEEDRCLRCIHQAKPDRLRDEEISDLEDAFRSLTCDPGGGVALASGPEAPAL
KAPAPKAPAPRVPVHSPPPPMQGQTFVFQGQEFANRPLNSDDQLKFARLVGRKWRTVGRA
LQCPALREQDLENLAYDYDRDGLFEQAFQLLHHFVQAEGRRATLQRLIEALDRSSLTSVA
EDLLGLPRVQEDGDHE
Download sequence
Identical sequences F7FRX7
ENSMODP00000007741 13616.ENSMODP00000007741 ENSMODP00000007741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]