SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007830 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007830
Domain Number 1 Region: 364-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 2 Region: 93-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number 3 Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 4 Region: 228-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 5 Region: 285-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 6 Region: 412-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number 7 Region: 192-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Integrin beta EGF-like domains 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007830
Domain Number - Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000229
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number - Region: 59-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number - Region: 140-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0106
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007830   Gene: ENSMODG00000006309   Transcript: ENSMODT00000007987
Sequence length 494
Comment pep:novel chromosome:BROADO5:7:95233330:95651562:-1 gene:ENSMODG00000006309 transcript:ENSMODT00000007987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTQGLSKFFLLASTLFFTVSSAVPQGFSPSLRSGPGATCRLSRAEAERRCRAPGQPPGS
ELCNGRGHCDCGVCICHVKEPGMYLGPLCECHEWVCEAYDGETCAGHGKCDCGKCKCDEG
WYGEACQYPTNCNLTKKKSNQMCKNSQDTICSNAGICHCGRCKCDNSEGNGLVYGKFCEC
DDRECIDDETEEMCGGHGKCYCGNCYCEAGWHGDKCEFQCDITPWESKRRCTSPDGKICS
NRGTCVCGECSCHDVDPTGDWGDIHGDTCECDERNCRSVYDRYSDDFCSGHGQCNCGRCD
CKVGWSGKKCEHPLSCPLSAEDSIKKCQGSANLPCSGRGKCECGQCTCYPPGDSRVYGKT
CECDDRKCENLDGTVCGGHGKCSCGRCICDKGWFGKLCQYSRKCNMTEEESKSLCESADG
ILCSGKGSCHCGKCICSSQEWYISGEFCECDDRDCDKHDGLICTGNGICSCGNCECWDGW
NGNACEIWLGAEYP
Download sequence
Identical sequences F7BR31
ENSMODP00000007830 XP_003341858.1.35504 ENSMODP00000007830 13616.ENSMODP00000007830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]