SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007833 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007833
Domain Number 1 Region: 447-711
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-52
Family YWTD domain 0.000000000676
Further Details:      
 
Domain Number 2 Region: 331-443,714-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000345
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 243-281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.00028
Further Details:      
 
Domain Number 4 Region: 197-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000746
Family LDL receptor-like module 0.00024
Further Details:      
 
Domain Number 5 Region: 76-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 6 Region: 153-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00027
Further Details:      
 
Domain Number 7 Region: 112-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.00034
Further Details:      
 
Domain Number 8 Region: 283-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007833   Gene: ENSMODG00000006311   Transcript: ENSMODT00000007990
Sequence length 906
Comment pep:known chromosome:BROADO5:3:429928554:429967624:-1 gene:ENSMODG00000006311 transcript:ENSMODT00000007990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFPYRRAKSRLGFRTKFKALLEPTVGLGHNRSRGKDSKPKGIEGSMKGLRSLDILLCSG
IIIVLTLSTATNAVDTCGRNEFQCQDGKCISYKWVCDGSPECKDGSDETMETCLSVTCKP
EEFSCGGRVNRCIPLTWKCDSQTDCENGSDEQDCPLKTCSHDQFRCHDGKCISQEFVCDA
DRDCNDGSDELDCPDPTCNPATFQCNSTQCIPKLWVCDGDQDCEDGSDEWPDKCGEQDLV
KKPKPCSSLEFHCGSGECIHMSWRCDGGHDCKDKSDEEGCVKATCRPDEFQCNDGECVHG
SRQCNKEYDCKDMSDEIGCVNVTLCEGPNKFKCHSGECISMDKVCNGPRDCRDWSDEPIK
ECGTNECLNNKGGCSHICNDLKIGYECLCPEGFRLIDQKRCEDIDECQNPDTCSQFCVNL
PGSYKCECYEGYQIDPITKTCKAIGTIAYLFFTNRHEVRKMTLDRSEYISLIPNLKNVVA
LDMEVASNKIYWSDLSQKKIYSSEIDSAHSLSTHDTVISGDIQAPDGIAVDWIHGNLYWT
DSVLGTISVANTKGSKRKTLFKQEGAKPRAIVVDPVHGFMYWTDWGTPAKIGKGGLNGVD
SFSLVTEAIEWPNGITLDLSSDRLYWVDSKLHSISSVDVNGGNRRIVLEDKNKLAHPFSL
AIFEDKVFWTDIINEAIFSANRLTGSDIILVAEDLLSPEDIVLYHNLTQPTGVNWCEKTS
LSNGGCQYLCLPAPQINSHSPKFTCACPDGMNLAADMRTCIKEAIVPVTSSKPIATKEPK
MTTLAGLVTAITRKPTIKHGTPDLTTAEMVTMSQKAVLNQMGIQESQEHHNGPTALSIVL
PIVLLILIAFGAFLVWKNWRLKNINSINFDNPVYQKTTEDEVHICRSQDGYTYPSRQIVS
LEDDIA
Download sequence
Identical sequences F7BQZ9
ENSMODP00000007833 ENSMODP00000007833 XP_001364957.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]