SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007842 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000007842
Domain Number - Region: 79-149
Classification Level Classification E-value
Superfamily Prefoldin 0.00034
Family Prefoldin 0.012
Further Details:      
 
Domain Number - Region: 25-98
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0115
Family SNARE fusion complex 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007842   Gene: ENSMODG00000006319   Transcript: ENSMODT00000007999
Sequence length 197
Comment pep:novel chromosome:BROADO5:3:429902563:429917523:1 gene:ENSMODG00000006319 transcript:ENSMODT00000007999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVFRDMEDVSQGLIGLLNANRAGAWVRRFLGKQERMIERLLDLKENAEGFLSEILAMEE
DVAQKLVDEKETAQHVESKLQKIESELQKASEKNGSLKANLNLLTKELEELKEMEQDLLR
MEGEVDEDTTVVIPSAVYVSQLYHQVSKIEWDYECEPTIIKGIHHGPNIAQPIHLDSTQH
SQKFISDYLWSLVDTQW
Download sequence
Identical sequences F7B3S4
ENSMODP00000007842 XP_001364888.1.35504 ENSMODP00000007842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]