SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007844 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007844
Domain Number 1 Region: 1550-1665
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-23
Family Synaptotagmin-like (S variant) 0.0057
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.82e-23
Family PLC-like (P variant) 0.025
Further Details:      
 
Domain Number 3 Region: 1136-1267
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.91e-23
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 4 Region: 339-467
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-20
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 5 Region: 193-327
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.12e-20
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 6 Region: 1775-1941
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.65e-17
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 
Domain Number 7 Region: 1300-1405
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000122
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000007844
Domain Number - Region: 612-760
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0798
Family Type II DNA topoisomerase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007844   Gene: ENSMODG00000006314   Transcript: ENSMODT00000008001
Sequence length 2080
Comment pep:novel chromosome:BROADO5:1:77868789:78031190:1 gene:ENSMODG00000006314 transcript:ENSMODT00000008001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRVIVESASDIPKGKFGKPDPIVSVIFKDEKKKTKKIDNELNPVWNEIFEFDLKGIPLD
FSSTLGITVKDFETIGQNKLIGVATISLKDLIGGQSRSLPYKLISLVNEKGQDTGATIDL
VVAYDPPAAMATNPNELSGITIEGTGEEEEEDTGDEDTAFKVIAPRVPATNISEAQLARR
ITKGKNTRKILSNKPQDFQIRVRVIEGRQLSGNNIKPVVKVHVCGQTHRTRIKRGNNPFF
DELFFYNVHMTPLELVDETISIRVYDSHSLRADCLMGEFKIDIGYIYDEPGHAVMRKWLL
LNDPEDISSGAKGYMKVSMFVLGTGDEPPTEKRDRDNDSDDVESNLLLPAGIAMRWVTFL
LKIYRAEDIPQMDDAFSQTVKEIFGANVDKKNLVDPFVEVCFAGKKVSTGIIEKNANPEW
NQVVNLQIKFPSMCEKIKLTVYDWDRLTKNDVVGTTYLYLSKIAASGGEVEDSSPSGAWA
ASSTEKTGETEVGFVPTFGPCYLNLYGSPREYTGFPDPYDDLNSGKGEGVAYRGRILVEL
NTLLEKTPPDKKVETISNDDLLVVEKYQRRRKYSLSAVFHSATMLQDIGEAIQFEVSIGN
YGNKFDATCKPLASTTQYSRAVFDGNFYYYLPWAQKKPVVTLTSYWEDISHRLDAVNTIL
VMAERLHVNIENLKSGIQAKMSGNHLAEMWLKLIDELIEDTSMPLPSLEGKSNVTILDTQ
IQKLRLRSLIQIQEAARKMRSEAKHVKSTLTEIEDWFDKLMQLSEEPQNSMPDIIIWMIR
GEKRLAYARIPAHQVLYSTTSEEASGKYCGKTQTIFLKYPQDRSYGVKVPAELRVNIWLG
LSAVEKKFNSFAEGTFTVFAEMYENQALMFGKWGTSGLVGRHKFSDVTGKIKLKKEFFLP
PKGWEWEGEWMVDPERSLLTEADAGHTHFTDEVYQNESRYPGGEWKAMEDSYTDVNGEKA
ASPNEMTCPPGWEWEDDAWMYDINRAVDEKGWEYGITIPPDNKPKSWVAAEKMYHTHRRR
RMVRKRKKDVTQSAASTARGWEALEDKEGWEYASLIGWKFHWKQRSSDTFRRRRWRRKMA
PSETHGSAAIFKLEGAIGADTTEDGDEKSTEKNKHSATTVFGANTPIVSCNFDRVYNYHL
RCYIYQARNLMALDKDSFSDPYAHVSFLHRSQTTEIIHSTLNPTWDQTLIFDDIEIFGEP
QTIIQNPPKVVIELFDNDQVGKDEFLGRSFCSPVVKLNPEVDITPKLLWQPVINGDKACG
DVLVAAELILKDKVGSNLPILPSQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNYQM
ASVTSPSLIIECGGERIESALIKNLKKTPNFPSSVLFMKVLLPKEELYTPPLVIKVIDHR
QFGRKPIVGQCTIDLLEQFRCDPYAFKEDIAPQVKASILSAPLSRDVVIEVEDTKPLLPT
KCLSSMSTAISKMTPPRTVHLTEKEEEVVDWWSKFYASVGEPEKCGQYIQKEYAKLKVYN
CELESVPEFKGLTDFSDTFKLYRGKSDEIDDPSVVGEFKGSFRIYPLPDDPNVPAPPRQF
RELPDSVPQECIVRIYIVRGIDLQPQDNNGLCDPYIKISLSKKVIEDRDNYIPNTLNPIF
GRMYELSCFLPQEKDLKISVYDYDTLTRDEKVGETIIDLENRFLSRFGSNCGIAEQYCIS
GVNTWRDQLKPTQLLCNVAKFKGLPLPILSEDGNRLRFGGREYTLEEFEANRNLHQHLGP
AEERLALYILRTQGQVPEHVETRTLYSTFQPNISQGKLQMWVDVFPKSLGPPGPPFNITP
RKAKRYVLRVIIWNTKDVILDEKSITGEEMTDIYVKGWIPGNEENKQKTDVHYRSLDGEG
NFNWRFVFPFEYLPAEQLCIVSKKEHFWSIDQTEFRVPPRLIIQIWDNDKFSLDDYLGFL
ELDLHNTIIPAKSSEKCKLDMISEYRAVNPLKSKTASLFEQKSMKGWWPCYAEKDGARVM
TGKVEMTLEVLNEKEVDERPAGKGRDEPNMNPKLELPNRPETSFLWFTNPCKTMKFIVWR
RFKWVIIGLLILLVLLLFLAVLLYSLPNYISMKIVRPNAK
Download sequence
Identical sequences F7B3P6
ENSMODP00000007844 ENSMODP00000007844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]