SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007874 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007874
Domain Number 1 Region: 41-491
Classification Level Classification E-value
Superfamily Cytochrome P450 6.02e-99
Family Cytochrome P450 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007874   Gene: ENSMODG00000006344   Transcript: ENSMODT00000008033
Sequence length 498
Comment pep:novel chromosome:BROADO5:1:78243201:78247336:-1 gene:ENSMODG00000006344 transcript:ENSMODT00000008033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSALLASALCTFVLPLLLFLAAVKLWDLYCLSTRDHSCSLPLPPGTMGLPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRQILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSLHKKRKKLIMQAFNREALQCYVPVIAEEIKNALERWLQCGDSGLLVYPE
VKRLMFRIAMRILLGCESGSATDGDSERELVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEKNICAKLGGQREPEAGGWRVKDVLQLLIEHTQENGERLDMQELKQSATELLF
GGHETTASAATSLITYLGLHHHVLQKVREELKTKGLLCKSSHDEKLDIDILEQLKYIGCV
IKETLRLNPPVPGGFRIALKTFELNGYQIPKGWNVIYSICDTHDVADIFTNKEEFNPDRF
LLPYPEDSSRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPT
VYPVDNLPTKFMHFKGEM
Download sequence
Identical sequences F7AFL4
XP_001375292.2.35504 ENSMODP00000007874 13616.ENSMODP00000007874 ENSMODP00000007874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]