SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007948 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007948
Domain Number 1 Region: 239-359
Classification Level Classification E-value
Superfamily Cadherin-like 5e-29
Family Cadherin 0.0021
Further Details:      
 
Domain Number 2 Region: 468-595
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-28
Family Cadherin 0.0031
Further Details:      
 
Domain Number 3 Region: 133-243
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-24
Family Cadherin 0.0026
Further Details:      
 
Domain Number 4 Region: 584-689
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-20
Family Cadherin 0.0041
Further Details:      
 
Domain Number 5 Region: 353-472
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-19
Family Cadherin 0.0059
Further Details:      
 
Domain Number 6 Region: 13-131
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000483
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007948   Gene: ENSMODG00000006409   Transcript: ENSMODT00000008110
Sequence length 1210
Comment pep:novel chromosome:BROADO5:7:157471446:157578282:-1 gene:ENSMODG00000006409 transcript:ENSMODT00000008110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGKDARLPQQGLLPPERGGGGGV
SIGAGRGKSGSYRVLENSAPHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFAND
KEICMIKVEIQDINDNAPSFPSDQIEMDISENAAPGTRFPLTSAHDPDAGDNGLRTYLLT
RDDHGLFALDVKSRGDGTKFPELVIQKALDREQQNHHTLVLTALDGGEPPRSATMQINVK
VIDSNDNSPVFEAPSYLVELPENSPLGTVVIDLNATDADEGQNGEVLYSFSSYVPDRVRE
LFSIDPKTGLIRVKGNLDYEENNLVEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIG
FVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGAGGGLGASGAGGSVPF
KLEENYDNFYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFSVKILDENDNPPRF
TKGLYVLQVHENNIPGEYLGSVLAHDPDLGQNGTVSYSIIPSHIGDVSIYTYVSVNPTNG
AIYALRSFNYEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDT
AELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNEDNLFEIDSSSGEIRTLHPFW
EDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIVTL
STISIILLAAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKGKKKKINKNDIMLVQS
EVEERNAMNVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHGGC
HTSFTGQGTNATETPSTRMSIIQPGTLLMVEGRCEAAQTDNFPAEPNYMGSRQQFVQSSS
TFKDPERASLRDSGHGDSDQADSDQDTNKGSCCDMSVREALKMKTASTKSQPLEQAFPTL
LSFAILTLHTITSRLQSVDLLLPEQEECVNCTDECRVLGHSDRCWMPQFPTTNQAENADY
RTNLFVPTVEANVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLKAKRALSPLL
QEVPSASSSPTKTCIEPCTSTKGPIDGCDAKPGALAEASNQYLSSDSQYLSPSKQSRDTA
FMANDQMARVFADVHARVSRDSNEMDSVLEQLDHSNRDLGRESVDAEEVVREIDKLLQDC
RGSDPVAVRK
Download sequence
Identical sequences F7FR90
ENSMODP00000007948 ENSMODP00000007948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]