SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008011 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008011
Domain Number 1 Region: 98-270
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.43e-60
Family G proteins 0.0000000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008011   Gene: ENSMODG00000006453   Transcript: ENSMODT00000008174
Sequence length 299
Comment pep:novel chromosome:BROADO5:3:429660919:429663606:1 gene:ENSMODG00000006453 transcript:ENSMODT00000008174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSLYSPTNLLYSFFLFIRSHPIGFVLFRRLPRHTFGLVQSKLFPFYFHISLACATISLG
IFLFHHPLVKLSFTLAEAGQMASAGDPHIAQKDAADQNFDYMFKLLIIGNSSVGKTSFLF
RYADDSFTSAFVSTVGIDFKVKTVYRNEKRVKLQIWDTAGQERYRTITTAYYRGAMGFLL
MYDVSNQESFNAVQDWATQIKTYSWDNAQVILIGNKCDLEDDRVVSTEDGKHLADDLGFE
FFEASAKDNINVKQVFERLVDIICEKMNESLEAGSGTIGNSKATALSDAPPAQSSNCSC
Download sequence
Identical sequences F7FH09
ENSMODP00000008006 ENSMODP00000008011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]