SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008088 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008088
Domain Number 1 Region: 296-478
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.99e-25
Family SPRY domain 0.024
Further Details:      
 
Domain Number 2 Region: 506-637
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000253
Family Nucleotide and nucleoside kinases 0.039
Further Details:      
 
Domain Number 3 Region: 7-45
Classification Level Classification E-value
Superfamily SAP domain 0.00000000678
Family SAP domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008088   Gene: ENSMODG00000006515   Transcript: ENSMODT00000008252
Sequence length 850
Comment pep:novel chromosome:BROADO5:2:142860967:142871550:1 gene:ENSMODG00000006515 transcript:ENSMODT00000008252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEASGGRPTLEPGNGS
LDLGGDSAGRSHTQPSGAGLEQEAATTADEEEEEEEEEEEEGIAALDGDQMELGEENGAA
GAADSGPMEEEEAGGSSEDENGDDQGFQEGEDELGDEEEEAGAGDENGHGEQQSPPTTPQ
QQQPQQQRGAAKEAAGKSGGPTSLFAVTVAPPSAARQAQQQAGGKKKAEGGGGGGRPGAP
AAGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVV
CLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRH
LYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGDKFDENDVISC
FANFEGEEVELSYAKNGQDLGVAFKINKEVLAERPLFPHVLCHNCAVEFNFGQKEEPYFP
IPEEYTFIQNVSLDDRVRGPKGPDEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNIL
GTNTIMDKMMVAGFKRQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAA
QRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGMKLLSLIPSK
GHWNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKSLPPEKKQNTGSKKSNKNKS
GKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPR
GPVFPSRGGYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKP
WSQHYHQGYY
Download sequence
Identical sequences F7E3Z9
ENSMODP00000008088 ENSMODP00000008088 13616.ENSMODP00000008088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]