SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008299 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008299
Domain Number 1 Region: 564-808
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.59e-84
Family Eukaryotic proteases 0.00000015
Further Details:      
 
Domain Number 2 Region: 369-457
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-38
Family Kringle modules 0.0000313
Further Details:      
 
Domain Number 3 Region: 273-358
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-36
Family Kringle modules 0.0000312
Further Details:      
 
Domain Number 4 Region: 88-183
Classification Level Classification E-value
Superfamily Kringle-like 1.42e-35
Family Kringle modules 0.0000342
Further Details:      
 
Domain Number 5 Region: 183-266
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-35
Family Kringle modules 0.0000239
Further Details:      
 
Domain Number 6 Region: 475-568
Classification Level Classification E-value
Superfamily Kringle-like 1.61e-33
Family Kringle modules 0.0000235
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 5.1e-19
Family Hairpin loop containing domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008299   Gene: ENSMODG00000006692   Transcript: ENSMODT00000008465
Sequence length 809
Comment pep:novel chromosome:BROADO5:2:442980962:443045164:-1 gene:ENSMODG00000006692 transcript:ENSMODT00000008465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYGKVVLFFLLFLKSGQGEPLESYVKTEGASLSSSQRNQYVANSAEECETKCETEIKFV
CRSFEYYNKEQKCVTMGENSKSSLVVRWRDVALFEKRMYLSECKSGNGRSYRGTWSKTKS
GITCQKWGDNSPHVPNYSPNLYPNEGLEKNYCRNPDNDPKGPWCYTTDPDTRYEYCDVPE
CEDECMHCNGENYQGTVSRTESGTECQRWDSQDPHSHEYIPSKLPNKNLKHNYCRNPDGE
PQPWCFTVDPNKRWEFCNISRCSTPPPSPGPMLQCLKGRGENYRGNIAVTKSGFTCQHWN
TQTPHKHNRIPEKFPCKHLDENYCRNPDGESAPWCYTTNSEQRWEYCDIPLCGSSPPQIE
AVVPPKQPNVIQECYEGNGQSYRGTSSTTNSGKKCQAWSSMIPHRHEKTPDKFPFADLIQ
NYCRNPDGDKSPWCYTTDPRVRWEFCNLEKCSGTGGTLPNSQTTRVPSVDKPSTEESDCM
FGTGKDYRGKRSTTAAGTLCQAWTAQEPHKNSIFTPQSYPRAGLEENYCRNPDGDRNGPW
CYTTDPKKLFDYCDIPQCASSTSFDCGKPRVEPHRCPGRIVGGCFAQPHSWPWQISLRTR
FGDHFCGGTLIAPQWVLTAAHCLERSTRPASYKVILGLHNEIPPEPYSQEIGVTEMFKAP
YRADIALLKLSRPATINDKVIPACLPSGDFVVPDRTLCHVTGWGETQGTSPRGQLKQASL
PVVANDVCNNRRYLGGRVKSTELCAGHLIGGEDSCQGDSGGPLVCFDNDKYILQGVTSWG
LGCARPNKPGVYVRVSKYVSWIEEVMRNN
Download sequence
Identical sequences F7F243
ENSMODP00000008299 ENSMODP00000008299 XP_007484920.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]