SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008308 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008308
Domain Number 1 Region: 277-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-65
Family SPRY domain 0.00000478
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 2.07e-22
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 3 Region: 82-138
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000107
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008308   Gene: ENSMODG00000008725   Transcript: ENSMODT00000008474
Sequence length 465
Comment pep:novel chromosome:BROADO5:2:251209623:251229712:-1 gene:ENSMODG00000008725 transcript:ENSMODT00000008474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPDLSANLQEEATCAICLDYFTDPVMTDCGHNFCRECISRCWGQTEGPFPCPECREMS
PQRNLRPNRPLAKMAEMARQLHPPSPVPQGLCGRHREPLKLFCEDDQALLCLMCERSRDH
WTHRVSQIEEAAEDYKVRRNPKGRVGRETSSERGDFVVKPDEWQNWSPHLNRRRGLGPAR
VVGRKILMNWNKQKLSGKEPRLKERLTACRSFILSLAVESILSHKSLRIVLYRCISASRE
VRYVCATVYPSLQDVKLQLPEVVSMELRTVCRVPGLVEMLRRFRGDVTLDPDTANPELVL
SEDRRSVRRGDIRQALPDSQERFDPGPCVLGREGFTSGRHYWEVEVGDRVNWALGVCKEN
VNRKETGELSTGNGFWILVFFGNYYYSPDRTFIPLREAPRRVGIFLDHEAGHISFYSVTD
GSLLFMFSQVAFSGTLRPLFSPLSCSPVPMTICQIIGGTGESFTS
Download sequence
Identical sequences F7DH42
ENSMODP00000008308 ENSMODP00000008308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]