SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008311 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008311
Domain Number 1 Region: 12-94
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.44e-18
Family FHA domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008311
Domain Number - Region: 1272-1359
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0327
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008311   Gene: ENSMODG00000006701   Transcript: ENSMODT00000008477
Sequence length 1585
Comment pep:novel chromosome:BROADO5:2:144882787:145007932:1 gene:ENSMODG00000006701 transcript:ENSMODT00000008477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTSWFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVVNYDASADEHLVKDL
GSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDILMKCDLYIRGEMRVPEEALKHEKFSSQ
LQLSQKSSEVELSKSASSKSIESKVADAATELQHKTTETLKSEEKSMDLSAVPRGTPLYG
QPSWWGDEEADEENAFKQDGKPEEKINDTGASGCSINAKQVEEQSATANEEVLYPFCREP
SYFEIPTKEFQQPSQITESTIHEIPTKDIQSSHAAGAGHASFTIEFDDNAPGKVTIRDHV
TKFTPDQRHKSKKSSPSGTQDIPGLQTGMMAPENKVADWLAQNNPPRMIWEGTEEDSKSI
KSDVPVYLKRLKGNKHDDGTQSDSENAGVHRHCSKRAVLEEHLRRHHSEQKRLHQKAQCI
EKHQEQVQTSSARHRAGHGVPHGKLLKQKSEEPSVPFLQASLLRSSGSLGHRPSQEMDKK
FKIPSASEKDNDDDQSDKGTYTIELENPNSEEVEARKMIDKVFGVDDGQDYNRPVINENQ
KDLIKDWALNSAAVVTEEKKTLITSGFLDSEEGTTSTGNKRWVSQWASLAANHTRHDQED
RTAELTASAPIENDTDISESGISVRSTGSTTSLTSQGERKRRTLPQLPNEDKSLENRVKI
LPPRSEIGEKQDTELQEKEAPTQTSPKERQDADRVQGKMNRTVNGQTLKSVGDTKTPFHL
NTCGPGKEKSETEREASLVKQALAKIQEQEQKDQAQWTPTKLASSKLAAGQGEKSKEEPL
RQGTHALEKALGHPAGKGERVIQSEGKRRKTEEILKNQTSKGPGGDKKEASKSLVRQGSF
TIEKPSTNIPIELIPHINKQTASTSSSFALTSVNSRIRERSDSMDTDSSMDTTLILKDTE
AVMAFLEAKLREENKTDEGPETPSYNRDNSISPESDVDTASTISLVTGDTERKTTQKRRS
LTSLYKDRCSTGSPSKDVSKSSSSSAREKIEKKTKSRSTDTGSRTESRKIVQTSGRIRQP
SVDLTDDDQASSVPHSAISDVMSSDQETYSNKSHGRAPFTTTDEHLHSKPEGTKLTKSKT
SPVATGSSSKSTTLPRPRPTRTSLLRRARLGEASDSELADADKASVASEVSTTSSTSKPP
TGRRNISRIDLLAQPRRTRLGSLSARSDSEATISRSNASSRTQESVVRSGARLNPSDKFS
PRIRANSISRLSDSKTRSMTSTHSSPSVNSRWRRFPTDYASTSEDEFGSNRNSPKHTRLR
TSPALKTSRLPSTGTATHTSSSFKHRIKEQEDYIRDWTAHREEIARISQDLALIAREIND
VAGEIDSVTSSGTAPSTTVSTAATTPGSAIDTREELVDRVFDESLNFRKIPPLVHSKPPE
GNSRPNDSKTQLTETPEHLTITRRRTWSRDEVMGDNLLLSSVFQFSRKIRQSIDKTAGKI
RILFKDKDRNWEEIETKLRAESEVPIVKTSSMEISSILQELKRVEKQLQVINAMIDPDGT
LEALNNLGFPTAVLPAQPKQKSSSESNHEDPVQTSPICQPEARALRPTDISVSAEFHNVE
SEADFSIHFNRFNPEGEEEDVTVHE
Download sequence
Identical sequences F7DGY3
ENSMODP00000008311 ENSMODP00000008311 13616.ENSMODP00000008311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]