SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008474 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008474
Domain Number 1 Region: 608-833
Classification Level Classification E-value
Superfamily vWA-like 1.71e-62
Family Integrin A (or I) domain 0.00037
Further Details:      
 
Domain Number 2 Region: 31-237
Classification Level Classification E-value
Superfamily vWA-like 3.34e-56
Family Integrin A (or I) domain 0.00026
Further Details:      
 
Domain Number 3 Region: 241-361
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-18
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 4 Region: 404-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.55e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 365-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000119
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 526-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000213
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008474
Domain Number - Region: 909-935
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0602
Family Chicken cartilage matrix protein 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008474   Gene: ENSMODG00000006840   Transcript: ENSMODT00000008642
Sequence length 940
Comment pep:novel chromosome:BROADO5:3:362351190:362551424:1 gene:ENSMODG00000006840 transcript:ENSMODT00000008642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKMVLGCCLLFFGQFLLFTAEARERRPPWPLSKGRNALAHPQTALLESSCENKQADLVF
IIDSSRSVSPYDFAKVKEFIVTILQFLDIGPDITRVGLIQYGSTVKNEFSLKTFKRKSEV
ERAVKRMMHLATGTMTGLAIQYAVNIAFSEAEGARPLRENVPRIIMIVTDGRPQDPVAEV
AAKARNTGILIFAIGVGQVDYNTLKSIGSEPHEDHIFLVANFSQIETLTSVFQNKLCVAH
MCNIMEHNCAHFCINTPGSYLCRCKRGYILNTDQKTCRIQDVCEMQDHACEQICVNVPGS
YVCQCYNGYTLAEDGKKCVVVDHCASANHGCQHECVNADNSYSCRCHKGFALNPDKKTCH
KLDYCASLNHGCQHECINTEDSYSCRCLKGFNLNPDKKTCKRINYCALRKHGCEHECANA
EDGYYCRCRPGYTLNPNGKTCRRLDHCAENNHGCEQLCLNTDDSYVCQCSEGFVINEDLK
TCTRVDYCLLTDHGCEHSCINTERSFACQCSEGFVLRSDGRTCKLLDLCALGDHGCEHSC
VSRGESYMCLCFEGYMLLDDGKTCKSKFALNLIQETCTKKCGEGHCVCPENGKANFSQSR
KCQSKDVCKSTNHGCEHTCVNDGNSYICKCSEGFVLAEDRKRCRKCTEGPIDLVFVIDGS
KSLGEENFEIVKHFVTGILDSLEISPKAARVGLLQYSTQVRTEFTLRDFHTARDMKKAVT
HMKYMGKGSMTGMALKQMFERSFMEREGARPPSARVPRVAIVFTDGRAQDDVSEWANRAQ
QNGITIYAVGVGKAIEEELQEIASDPPDKHLFYAEDFSTMGEISEKLKKGICEALEDSNG
NQDSPASDLPKMAQQPPEPEPVTINIQDLLSCSNFAVQHRYLFEDDSLSQSTLRLFHSTK
TKGSPSEDKHDQCKCENLLTFQNFANEEVRKLTERYILCL
Download sequence
Identical sequences F6PFY6
ENSMODP00000008474 ENSMODP00000008474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]