SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008532 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008532
Domain Number 1 Region: 62-145
Classification Level Classification E-value
Superfamily HMG-box 2.75e-24
Family HMG-box 0.0005
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008532
Domain Number - Region: 197-265
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008532   Gene: ENSMODG00000006884   Transcript: ENSMODT00000008700
Sequence length 323
Comment pep:novel chromosome:BROADO5:3:448781919:448786527:-1 gene:ENSMODG00000006884 transcript:ENSMODT00000008700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSPKQLVPGLLPSNGKVPGQQQSGSFAGLAPVKQEKVDGPRASGMEKGPSEEEPVKKR
GWPKGKKRKKILPNGPKAPVTGYVRFLNERREQIRTLHPDLPFPEITKMLGAEWSKLQPT
DKQRYLDEAEREKQQYMKELREYQQSEAYKMCAEKLQEKKTKKEDPGASAMNTLLNGHKG
GDFDGFSTFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQSMSSARERL
EQEVAREERRTLALQQQLRAVRQALTASFASLPVPGTGETPTLSTLDFYMAKLHGVIERD
PMQHEKLILRIKEILSRIASEHL
Download sequence
Identical sequences F6PVS9
ENSMODP00000008532 ENSMODP00000008532 XP_007489232.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]