SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008573 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000008573
Domain Number - Region: 614-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family EGF-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008573   Gene: ENSMODG00000006917   Transcript: ENSMODT00000008743
Sequence length 902
Comment pep:novel chromosome:BROADO5:6:122404897:122478511:-1 gene:ENSMODG00000006917 transcript:ENSMODT00000008743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQNSGLFPLQHQEQPLFLPFSHPLSQAQPLYLSLSQQDSLPLSQPLSQPRPLSQPQPLS
LPLPQPLSLPLNQPLFLSQPLSPPLPLSQSLSVSKPLSLSKPLSLSQFLSLTLSQPLPLS
QPWLWSGLQLPPSLFLLLLLLFVLCPGAGGLFLTDYSTCSPRKLSPFRSFASTELFHFHV
PEDTVLAVWNLIIFKEQGGTFGDHCPDQSVTVYFRSGAPPVINPLNTHFPPDTVVPGVFS
LTLSWTLPNRTSGIFNVSSPLPGDWFLAAHLPQAHGRISVKGLHDECQYLLQPQLIVRRL
LDVAVLVPGRPSEQTLSSHNHSALYKVFVPSFTSKVSVQLKCVGSRGGSGCPLMMHLRPK
APPLHNSTSVACGELAPCGLELALPPWGDWVYVRVETPRGLPGTLRFQLCVQLQECPQHG
LSRALVPGAAMNMPQSLGTQLPPQEIPPLGAPEEGSGSISPPDHCWPVRPTLRNELDTFS
VHFYIFFGPSVALPPGRPAVFALKLLPVLDSGGVLTLELQLNVSSLRQENATVFGCLTHE
VPLSSGDSSVTCSTESLAGFILSVNAASKVSRLRIPFPQTGTWYLTLRSLCGTGPWFERC
KNITAEVRLRTFLSPCIDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYG
FQLLSTLLLCLSNLMFLPPVVVAVRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMD
YDVLQFCDFLGSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPS
LFALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIH
SIWHMLIAGSVGFLLPPRAKSDGKVPPLSRPRGCGYQLCINEQEELGLVGSGGTSINSIC
AS
Download sequence
Identical sequences F6PSC3
ENSMODP00000008573 ENSMODP00000008573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]