SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008584 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008584
Domain Number 1 Region: 321-385
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000114
Family Ovomucoid domain III-like 0.0065
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000108
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 3 Region: 544-600
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000721
Family Ovomucoid domain III-like 0.0039
Further Details:      
 
Domain Number 4 Region: 402-451
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000101
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 5 Region: 754-816
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000194
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Domain Number 6 Region: 467-516
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000222
Family Ovomucoid domain III-like 0.014
Further Details:      
 
Domain Number 7 Region: 164-213
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000036
Family Ovomucoid domain III-like 0.0089
Further Details:      
 
Domain Number 8 Region: 71-141
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000043
Family Ovomucoid domain III-like 0.0064
Further Details:      
 
Domain Number 9 Region: 642-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000226
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 10 Region: 236-284
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000319
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 11 Region: 696-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008584   Gene: ENSMODG00000006925   Transcript: ENSMODT00000008754
Sequence length 993
Comment pep:novel chromosome:BROADO5:Un:50120563:50402961:1 gene:ENSMODG00000006925 transcript:ENSMODT00000008754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCGFGAVCEQSAGRATCVCKKGPCPTVVAPVCGSDASTYSNECELQRAQCSQQRRIRVV
SRGPCGSRDPCSGVTCSFGSTCARSADGQSAKCICPTSCSGVPEGIVCGSDGRDYPSECQ
LHRLACARQENIVKKFDGPCDPCKAVLSDLNRVCWVNPRTRQPDMLLRPESCPPRQEPVC
GDDGVTYINDCIMGRTSATQGLDIQKLRSGQCQPQDQCPSPCKFNAVCLIRRGRARCSCD
RVTCDGAYRPVCTHGGHTYASDCERQRAECSQQRALPVKHQGPCALPVGRTEAPEPPRGS
HPTPPGAPAARDQDTPSPCLGVQCPFGATCVVRNWEAVCECQQVCAGLYDPVCGNDGVTY
GSPCELEATACVLKKEILVTRKGPCGLCGKCQFGALCEAETGRCVCPTECVPSAQPVCGS
DGNTYGSECELHVHACTRQITLSVASPGHCKTCGDTVCAFGAVCSQGRCVCPRCERPPPS
PVCGSDGVTYGSSCELREASCQQQQRIEEARPGPCEDECGSGGSGSGEDGDCEQERCRWW
GGVWDEDSEDNWCVCDFSCQTVLRSPVCGSDGITYGNECELKKARCESQRDLYVTAQGAC
RGTPTMVPPPPVLHCSQTPYGCCLDNVTRAQGVGLAGCPSTCQCNPYGSYGGGCDPTSGQ
CSCRPGVGGLKCDRCEPGFWNFRGIVTDSRSGCTPCNCDPGGAVRDDCEQMTGLCSCKEG
ITGMKCSQCPPGSILGPSGCEKDPSAPKSCAELSCEFGASCVETGGSAHCECPAPMCPED
NMSKVCGSDGVTYGDPCQLRTIACRQGRTITVRHFGHAHSTHRSRPTTRPSVPAWTTAGV
RRTTARPAVPVRTTPGLHRTTTWPSMPTWTTAGVHRSTVRPILTAPVASAASPTLAYSES
GSADDNSGDEELSGDLEVSGAGSAGTELLEEGGVAAPTATIERASCYNLPLGCCSDGETP
ALDAEGTNCPATKGFLAFLLSHVTAKGTMAPKQ
Download sequence
Identical sequences H9H689
ENSMODP00000008584 ENSMODP00000008584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]