SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008673 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008673
Domain Number 1 Region: 1-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.33e-86
Family FCH domain 0.0000000000817
Further Details:      
 
Domain Number 2 Region: 331-355,581-638
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-16
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008673
Domain Number - Region: 433-504
Classification Level Classification E-value
Superfamily HR1 repeat 0.00523
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008673   Gene: ENSMODG00000006998   Transcript: ENSMODT00000008844
Sequence length 646
Comment pep:novel chromosome:BROADO5:1:456156765:456347250:-1 gene:ENSMODG00000006998 transcript:ENSMODT00000008844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIEISYAKQLRNLSKKYQPKRNSK
EEEEYKYTSCKAFLSTLNEMNDYAGQHEVISENMTSQITVELTRYVQELKQERKSHFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQLRH
QMAEDSKADYSTTLQKFNHEQHEHYYTQIPSIFQKIQEMEERRIVRIGESMKTYAEVDRQ
VIPIIGKCLDGIAKAAESIDQKNDSQLVIEAYKSGFEPPGDIEFEDYTQPMKRTISETSL
SNSRGDSKTELKFGSKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSP
KQQKEPLSHRFNEFMTSKPKIHCFRSLKRGTQSFSFHKELMKRTIGKPTYAFEAREYVLS
LKLGAGPEDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYIKNPQMGDPG
SLDHKLTEVGQNIEKLRLEVQKFEAWLTEVEGRLPIRGEHPRRQSGMYEAQNTPSVNNCA
QDRESSPDGSYTEEQSQENELKMMATDFDDEFDDEEPLPTIGTCKALYTFEGQNEGTISI
AEGEILYVIEEDKGDGWTRIRRNEDEEGYVPTSYVEVYLDKNAKDS
Download sequence
Identical sequences F6XVG3
ENSMODP00000008673 ENSMODP00000008673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]