SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008704 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000008704
Domain Number - Region: 34-127
Classification Level Classification E-value
Superfamily Release factor 0.022
Family Release factor 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008704   Gene: ENSMODG00000023076   Transcript: ENSMODT00000008876
Sequence length 215
Comment pep:novel chromosome:BROADO5:1:669175597:669176244:-1 gene:ENSMODG00000023076 transcript:ENSMODT00000008876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKALADAKALVERLRDHDNAAESLIEQTTALNKRVAAMKQYQEEIQELNEVARHR
PRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDP
GIIMKLKEQHSKELQVHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREIL
QITRESFLSLKKDDASESTSLSALVTNSDLSLRKS
Download sequence
Identical sequences F6UX75
13616.ENSMODP00000008704 ENSMODP00000008704 ENSMODP00000008704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]