SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008707 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008707
Domain Number 1 Region: 107-196
Classification Level Classification E-value
Superfamily GTF2I-like repeat 1.03e-34
Family GTF2I-like repeat 0.00077
Further Details:      
 
Domain Number 2 Region: 557-652
Classification Level Classification E-value
Superfamily GTF2I-like repeat 3.66e-33
Family GTF2I-like repeat 0.0000609
Further Details:      
 
Domain Number 3 Region: 451-542
Classification Level Classification E-value
Superfamily GTF2I-like repeat 4.71e-33
Family GTF2I-like repeat 0.00012
Further Details:      
 
Domain Number 4 Region: 718-811
Classification Level Classification E-value
Superfamily GTF2I-like repeat 1.7e-31
Family GTF2I-like repeat 0.00000431
Further Details:      
 
Domain Number 5 Region: 852-940
Classification Level Classification E-value
Superfamily GTF2I-like repeat 4.58e-31
Family GTF2I-like repeat 0.00086
Further Details:      
 
Domain Number 6 Region: 347-432
Classification Level Classification E-value
Superfamily GTF2I-like repeat 3.4e-29
Family GTF2I-like repeat 0.000096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008707   Gene: ENSMODG00000007022   Transcript: ENSMODT00000008879
Sequence length 987
Comment pep:novel chromosome:BROADO5:2:514054704:514134344:-1 gene:ENSMODG00000007022 transcript:ENSMODT00000008879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVAMSTVSVDDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTE
RGRAFVNTRKDFQKDFVKYCVAEGEKAAELHKMRSASHPNRTTVDAVEIETLRKTVEDYF
CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDVTTLKWILENKAGI
SFIIKRPFLEPKKQLGKPLSLKGSLISFSFSCPIKVKTEPTEDSGISLEMAAVTVKEESE
DPDYYQYNVQAGPSETGGVDEKLPLSKSFQGSHHSSEGNEGTEMELPVEDSTQHAPSETS
EDPEVEVTIEDDDYSPPSKKPKNPEPVNEAANAGKRKVREFNFEKWNARITDLRKQVEEL
FERKYAQAIKAKGPVAIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLERILLAKER
IRFVIKKHELLNSTREDLQLEKPTSGVKEEWYARITKLRKMVDQLFCKKFAEALGSTEAK
AVPYQKFEAHPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHST
PEITQPRTNTPVKEDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVFESNPEFLY
VEGLPEGIPFRSPTWFGIPRLERIVRGSNKIKFVVKKPELVLSYLPPGMASKVNTKALQS
SKRARSPGSNSKVPEIEVTVEGPNNKPQTTAVRTPTQTNGSNTPFKPRGREFSFEAWNAK
ITDLKQKVENLFNEKCGEALGLKHPVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIP
RLEKILRNKAKIKFIIKKPEMFETAIKESTSKSPPRKINSANVTTTAAGVEDLNIIQVTI
PDDESERLSKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITINPGCVVVDGMPP
GVAFKAPSYLEISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQTESEGPVIQESTDPS
QLEVPVTEDIKETEGSSQIKQEPDPTW
Download sequence
Identical sequences F6UX48
ENSMODP00000008707 13616.ENSMODP00000008707 ENSMODP00000008707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]