SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008726 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008726
Domain Number 1 Region: 119-209
Classification Level Classification E-value
Superfamily GTF2I-like repeat 1.09e-34
Family GTF2I-like repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 24-93
Classification Level Classification E-value
Superfamily GTF2I-like repeat 3.14e-25
Family GTF2I-like repeat 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008726   Gene: ENSMODG00000007038   Transcript: ENSMODT00000008899
Sequence length 281
Comment pep:novel chromosome:BROADO5:2:514244134:514292456:-1 gene:ENSMODG00000007038 transcript:ENSMODT00000008899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAPCSRHLPGFDGEACSPLRVPGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRK
PCTFGSQNLERILAVADKIKFTVTRPFQGLIPKPAPRRSAAPGKAFAAADDEDDANRLGE
KVILREQVKELFNEKYGEALGLNRPVLVPYKLIRDNPEAVEVTGLPDDIPFRNPNTYDIH
RLEKILKAREHVRMVILSQLQPFAEICGEAKQPVKDSSVPKRKRKRVSEGNSISSSSSSS
SSSSSNLESTASTNQISLVQWPMYMLDYGGLNVHIPGPINY
Download sequence
Identical sequences F6UFM9
ENSMODP00000008726 ENSMODP00000008726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]