SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008821 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008821
Domain Number 1 Region: 7-324
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.96e-57
Family beta-N-acetylhexosaminidase catalytic domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008821   Gene: ENSMODG00000007111   Transcript: ENSMODT00000008994
Sequence length 473
Comment pep:novel chromosome:BROADO5:2:264633728:264665079:-1 gene:ENSMODG00000007111 transcript:ENSMODT00000008994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSSPFKMQLVHLDLKGAPPKVLYLAEIFPLFHALGANGLLIEYEDMFPYEGPLQLLRA
RHAYSHSEIKEILHLAKLHDLEVIPLVQTFGHMEFVLKHKQFAHLREVELFPNALNPHKE
ESLALVGTMIDQVMELHKGIRWFHIGCDEVYYLGEGELSKQWLQQEQNNMVKLCLTQMKA
VARHVLIHHPTVKPIVWDDMLRGISEEYLTESGIAQLVEPMIWDYIEDMDVYGKVLLMDK
YRKCGFPKLWVASAFKGATGVNQSLTIIGHHLKNNIQWLKVAESGPTEMLQGIVLTGWQR
YDHFSVLCELLPVGIPSLAVCLQALKYGGYTENVKKIVEKYLGISNLEINSFMSESSGTF
PGSDVFALVTQVSFHLRLSVDELLERNRYVTGWFSPYHRKRKTIHPVMIQYIQPDAISLL
ARWNAVIQELQAALERIFYPDAIEEWLEENIHPTMQKLQQLLKDLDAAIAAHS
Download sequence
Identical sequences F6SI50
ENSMODP00000008821 XP_007483496.1.35504 XP_007483497.1.35504 XP_007483498.1.35504 XP_007483499.1.35504 XP_007483500.1.35504 ENSMODP00000008821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]