SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008854 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008854
Domain Number 1 Region: 39-338
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.32e-80
Family Pancreatic carboxypeptidases 0.00000000366
Further Details:      
 
Domain Number 2 Region: 339-421
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.08e-19
Family Carboxypeptidase regulatory domain 0.000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008854   Gene: ENSMODG00000007140   Transcript: ENSMODT00000009028
Sequence length 468
Comment pep:novel chromosome:BROADO5:8:26891178:26972532:1 gene:ENSMODG00000007140 transcript:ENSMODT00000009028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRGAPGAAAAAAAAASGAVSAWARNMDLSLYLCVGLLVPLVAPLDFKYHHQEEMEAFLKN
VAQTHDSITHLHSIGKSVSGRNLWVIVVGRFPREHRIGIPEFKYIGNMHGDEVVGRELLL
HLIDYLVSNDGRDPEITRLINNTRIHIMPTMNPDGFESIEIRDCYSSDGRFNENQFDLNR
NFPDAFENNSEVRQPETLAIMKWLKSESFVLSANLHGGALVASYPFDNGVVATGTNRGHS
LTPDNDVFEYLAYTYSSKNPKMSQGDACDNMNFRNGITNGFTWYPLKGGMQDYNYIWSQC
FEITLELSCCKYPPAEDLPSFWNDNRNSLISYMKQVHLGVKGQVFDVNKNPIANAIVEST
DRKHICPYRTNRFGEYFLLLLPGSYTINATVPGHKSILKEVTIPDNMQNFSALRMDFHFP
FQVKSHNTTTRLSCSEVPLYMYLENHSERLKSHFILFLMTFVSLFYIK
Download sequence
Identical sequences F6RZ59
ENSMODP00000008854 ENSMODP00000008854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]