SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008886 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008886
Domain Number 1 Region: 380-546,598-754
Classification Level Classification E-value
Superfamily L domain-like 1.19e-47
Family Ngr ectodomain-like 0.0000498
Further Details:      
 
Domain Number 2 Region: 160-366
Classification Level Classification E-value
Superfamily L domain-like 1.91e-41
Family Ngr ectodomain-like 0.00023
Further Details:      
 
Domain Number 3 Region: 1023-1213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-39
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 4 Region: 20-128
Classification Level Classification E-value
Superfamily L domain-like 6.12e-28
Family Ngr ectodomain-like 0.0035
Further Details:      
 
Domain Number 5 Region: 909-1037
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000235
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 878-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000323
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 837-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000739
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 795-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000034
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 9 Region: 1294-1325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000129
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 1250-1287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008886
Domain Number - Region: 1217-1247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0171
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008886   Gene: ENSMODG00000007165   Transcript: ENSMODT00000009061
Sequence length 1404
Comment pep:novel chromosome:BROADO5:1:367164291:367513187:-1 gene:ENSMODG00000007165 transcript:ENSMODT00000009061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVFLWYPMIYHQQKHFPRDLSENQIQGIPRKAFRGITDVKNLQLDNNQISCIEDGAFRA
LRDLEILTLNNNNISRIPVTSFNHMPKIRTLRLHSNHLYCDCSLAWLSDWLRQRRSIGQF
TLCMAPVHLRGFSVADVQKKEYVCTGPHSEPPSCSVNSIACPSSCTCSNNIVDCRGKGLT
EIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTS
LVLYGNKITEISKGLFDGLVSLQLLLLNANKINCLRVNTFQDLHNLHLLSLYDNKLQTIS
KGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIK
SKKFRCSGSEDYRNKFSGDCFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHIPEYVTDLRL
NDNEISVLEATGIFKKLPNLRKINLSNNKIKEVREGVFDGAVNVQELMLTGNQLELVHGR
MFRGLTSLKTMMLRSNLISCVSNDTFAGLSSVRLLSLYDNRISTITPGAFATLVSLSTIN
LLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNDESSC
QLAPRCPEQCTCVETVVRCSNKGLRVLPKGIPKDVTELYLEGNHLTTVPKELSTLRHLTL
IDLSNNSISVLANYTFSNMTQLSTLILSYNQLRCIPIHAFNGLRSLRVLTLHGNDISSVP
EGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPDHMADRLLLTTP
THRFQCKGPVDISIAAKCDPCLSGPCKNNGTCSKDPVELYRCSCPYGYKGRDCNMPINTC
IQNPCQHGGTCHLSETNRNGFSCSCPLGFEGERCEINPDDCEDNDCENNSTCVDGINNYV
CVCPPNFTGELCDEVIDHCVPEINLCQHEAKCISLDKGFRCECPPGYSGKLCETDDDDCV
AHKCRHGAQCIDTVNGYTCICPQGFSGLFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQ
EPTCRCLPGFAGQRCEKLITVNFVGKDSYVELASAKIRPQANISLQVATDKDNGILLYKG
DNDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAP
KSLGKLQKQPTVGTNTPLYIGGIPTSTGLSALRQGTDRTLGGFHGCIHDVRINNELQDFK
ALPQQSPGVFPGCKSCTICKQGMCRSVEKGSVVCECHPGWTGPLCDQEAGDPCLNHRCVH
GKCVASGSTYTCRCAEGYVGTSCDQKNDSLNPCRDFRCYHGQCHISERGQPYCECEPGFS
GEHCERESQCQGEVVREVIRRQQGYASCATASKVPLMECRGSCGSQCCVPIRSKRRKYVF
QCTDGSSFVEELERHVECGCHKCS
Download sequence
Identical sequences F6RCT0
XP_007474049.1.35504 ENSMODP00000008886 ENSMODP00000008886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]