SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008893 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008893
Domain Number 1 Region: 15-170
Classification Level Classification E-value
Superfamily ARM repeat 2.96e-22
Family Armadillo repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008893   Gene: ENSMODG00000007172   Transcript: ENSMODT00000009068
Sequence length 190
Comment pep:novel chromosome:BROADO5:2:214250559:214286138:-1 gene:ENSMODG00000007172 transcript:ENSMODT00000009068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKPRVVPEGGRLEYLQALVTEFQETASQEAKEQVLANLANFAYDPNNYQYLRELQVLD
LFLDVLSEDSDTLVEFAIGGLCNLCLDKVNKEYILQMGGVKPIINCLSSSNEETVMSAVT
TLMFLSTSQSIQELTALPVVECMLRFSLSANKRLSNLATIFLEDYCSPDQVEEARNLSAH
TAVGIPLPKD
Download sequence
Identical sequences F6RCA5
ENSMODP00000008893 XP_007482732.1.35504 XP_007482733.1.35504 ENSMODP00000008893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]