SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008947 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008947
Domain Number 1 Region: 18-116
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 3.14e-49
Family SWIB/MDM2 domain 0.00000944
Further Details:      
 
Domain Number 2 Region: 286-330
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 1.88e-19
Family Ran binding protein zinc finger-like 0.0000738
Further Details:      
 
Domain Number 3 Region: 189-279
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 8.5e-17
Family SWIB/MDM2 domain 0.033
Further Details:      
 
Domain Number 4 Region: 430-478
Classification Level Classification E-value
Superfamily RING/U-box 0.00000146
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008947   Gene: ENSMODG00000007219   Transcript: ENSMODT00000009124
Sequence length 484
Comment pep:novel chromosome:BROADO5:8:26990778:27018505:-1 gene:ENSMODG00000007219 transcript:ENSMODT00000009124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNTKMSSDTDGALSTSQMPASEQEALVRPKPLLLKLLKFAGAQKDTFTMKEVLFYLGQY
IMSKQLYDKKQQHIVYCSDDLLGDLFGVPSFSVKEHRRLYAMISRNLIAVNQQQEPAFPN
TSRNETRCQLEIASGQKESVQELQEEKPSPNLNSRPTTSSRRRTLSETEENLDELPGERH
RKRHKSDSISLPFDESCALCVISEICCERSNSSDSTEIPSSPDIDTGVLSENSDDSVSDQ
FSVEFEVESIDSDDYSHNEEGQELTDEDDEIYQVTVYEAEESDTDSFDEDPEISLADYWK
CTSCDKMNPPLPSHCHRCWALRENWLPEEKSDMSADKGKLENPTQGEEEGFDLPDCKKNK
MNDSQDSSIEENDEKIIQLSESQESEDYSQPSTSKSIICSSQEDARDFEREEAQDKERSM
ESIPPSTVEPCVICQSRPKNGCIVHGRTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVL
TYFL
Download sequence
Identical sequences F6WSI6
ENSMODP00000008947 XP_001373571.2.35504 ENSMODP00000008947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]