SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008961 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008961
Domain Number 1 Region: 362-456
Classification Level Classification E-value
Superfamily Immunoglobulin 9.9e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 211-260
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 287-363
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000889
Family Pre-dockerin domain 0.061
Further Details:      
 
Domain Number 4 Region: 147-208
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008961
Domain Number - Region: 552-603
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000379
Family Pre-dockerin domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008961   Gene: ENSMODG00000007229   Transcript: ENSMODT00000009138
Sequence length 1252
Comment pep:novel chromosome:BROADO5:3:450049770:450072571:1 gene:ENSMODG00000007229 transcript:ENSMODT00000009138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFLPFLTLCLAAAQLAGAPEALTRKDAQGPDLARGTSQRKMVRHAPSPEDNLEDGLAE
WTSWFNVDHPGGDGDFESLEAIRFYYGERLCAHPLALEARTTEWELPSDVGERVHYSLER
GFWCLNREQPEGKSCSNYHVRFKCPLDPVTWSAWSSWSPCSQSTCGVRSLGSQTRQRRCL
GPQPLWLLQLPPCVGPSEEQRPCPASPCSGPSWSEWGAWGPCSGSCGPGRRLRRRRCPGA
KKNACVGRSVEAQKCVRAPCPGCHSNCGHGGAGKDCSVCVCQDHVLVGTVVTPTGRPLPG
ARVTLKGRPKPSLAITDARGSFRVAGICSDGHTNVSVQLEGFAPGVGQAVANNSTMASVT
VILRTLEKPYLVKQPESRVREAGHHVMFCCKALGTPVPKKYYWYHNGSLLDRKVYKYDSN
LILRNLGPGQAGTYHCKANSDAGTIKSNTAVLTVLSPEQQVCDPRPLEHLIKLPDDCRQA
ASGSAYYNVGLCPDTRCPGRPGSNLRCGESSDRCCSVSRLETREIRCAGYVLPVKVVAKC
GCEKCMPPKVLVRGRVVAADTEEPLRFAQILLGKEKTGFTGYQGDFTIEVPPATERLVVT
FIDGRREFVDAIKVLPFDPRGGGVYQEVKVMRKKEPIRLDADKSNTIPLGTAEGMDPIGE
IVIPSGAFYYANGEPYNGTVQASVTFLDPRDLATAAAASSDLSFVDDNGELAPLRTYGMF
LVDLRAEGSGEELQTGRVEVRMDAGQIHMAGHAEEMKLWSLNPTTGLWEEESSFHMENAG
RRVRREERTFLIGNVEIQERRLFNLDVPERRRCFVKVRAYINEKFIPSEQVEGVVVTLVN
LEPAPGYSANPRAWGRFDSAVTGPNGACLPAFCDAERADAYTAYVTAALGGEELEPAPSS
PQPHPGTVGVTQPYLDKLGYRRTDHDDPALKKNGFRINLAKPNPNNLDEIQGPIYPWRSL
RECEDAPVTANHFRFSRVEADKYEYNVVPFRESELASWTGDYLSWWPNPQEFRACFIKVK
IQGPQDYMVRSHNAGGSHPRTQGQLYGLRDARSVKDMEHPGTSAACVEFKCSGMLFDQRL
PDRTLVTLVPQGSCRRIAVNSLLREYLARHPPVAPTDDPSGFSMIAPVDPLGHNYGIYTV
TDQNPRLAKEIAIGRCFDGTSDGFSREMKADVGTALTFQCQERPAGQRSLFQRLLDSPRT
ALEDIRREMGGPGRRSLNPFPTRRIPGRRRRMEMLQAGAVNETVTRNPEDAP
Download sequence
Identical sequences F6WCC4
ENSMODP00000008961 XP_016287669.1.35504 ENSMODP00000008961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]