SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009015 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009015
Domain Number 1 Region: 51-512
Classification Level Classification E-value
Superfamily Cytochrome P450 5.11e-137
Family Cytochrome P450 0.000000000000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009015   Gene: ENSMODG00000007273   Transcript: ENSMODT00000009192
Sequence length 512
Comment pep:novel chromosome:BROADO5:5:246670762:246684993:1 gene:ENSMODG00000007273 transcript:ENSMODT00000009192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLSGGNGGGRGPRGPEGLGEAALGAFILFLLLLLLLLLLLRSRRQARFPPGPAGLPFI
GNIFSLAASAELPHVYMEQQSRVHGQIFSLDLGGLFTVVLNGYDMVKECLIHQSEIFADR
PALPLFKKLTKMGGLLNSTYGRGWLDHRRLAVNSFRCFGSGQKSFESKIAEEAKCFIDAV
DTYQGKPFDLKQLITNAVSNITNVIIFGERFSYEDTEFQHMIEIFSENVELAASASVFLY
NSFPWIGIFPFGKHQQLFKNAAVVYDFLSKIIEKVSANRKPQSPQHFVDAYLDEMDKGRN
DPGSTYSKENLIFSVGELIIAGTETTTNVLRWAILFMGLYPNIQAQVHKEIDLIVGPNRT
PSLEDKPQMPYTEAVLHEVLRFCNVVPLGIFHATSQDTVVRGYSIPRGTTVITNLYSVHF
DKKYWKDPEVFYPERFLDSQGQFVKKEALVPFSLGRRHCLGEQLARMEMFLFFTSLLQRF
HLHFPPDLVPNLKPKLGMTLQPLQYLICAEKR
Download sequence
Identical sequences F7FQQ9
ENSMODP00000009015 ENSMODP00000009015 XP_007497100.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]