SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009161 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009161
Domain Number 1 Region: 557-672
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-21
Family Cadherin 0.0057
Further Details:      
 
Domain Number 2 Region: 121-235
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-19
Family Cadherin 0.00032
Further Details:      
 
Domain Number 3 Region: 335-442
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 444-541
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000186
Family Cadherin 0.0021
Further Details:      
 
Domain Number 5 Region: 55-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000143
Family Cadherin 0.0075
Further Details:      
 
Domain Number 6 Region: 245-341
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000343
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 661-764
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000105
Family Cadherin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009161   Gene: ENSMODG00000007386   Transcript: ENSMODT00000009342
Sequence length 835
Comment pep:novel chromosome:BROADO5:3:357511717:357583850:-1 gene:ENSMODG00000007386 transcript:ENSMODT00000009342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTQTSLHSLLLILLYLMTGYGQDGEFRGPLKPMVFSISEGEEKTNQVIFQFKTNTPNGK
FQLSGETDNIFHINPDGILYYTGILDREKRAVHNLQVEVLDASGKLVEGPFPITIEVKDI
NDNRPVFLQTRYNGTVRQNSRPGKPFMYVNATDRDDPTTLHAKLFYRIAIQLPKIKDVMY
FQINNQTGGISLTLEGSKELDPFKNDRYDLVVSVMDMGGQSDNSFSDTASVDIIVEENIW
KAPGLVTIKENSTEPHPLKITQVRWNEPGAHYFLYEKEKLPRFPFSIDQDGIIYATEPLD
REEKDSYVFYAAVKDENARLIARPLEIQVEITDINDNPPVCPSLVTVFEVQENEKIGSNI
GVFQAHDMDQQGTTNSFLQYEIVEQSPLLPSEGLFLIQKVSAVIQLAKGSLRKQDVSQYH
LKVQVSDPDFKTICHVIVNVIDINDQIPIFEKNSYGNLTINEDAAVGTTILTIQATDADE
PFTGSSKILYNIVEGDPNRKLVIETDPITNAGYVKINKPLDFETEPMYNLVIKAENPEPL
VKEVHYNESSYAHFFLKVSDVNEPPVFSRALYQAQVLENADINTKLIMVNATDPEGLPVS
YSLSGDTQGWLRIDGVTGEIFTMKHLDREAAKNYQVKVIATEKGRSFLTSSVYFHLTLMD
VNDNPPRLVKDYTGFFFCYPLKAKGSVIFEATDDDQPPHRGFDFTFSLGSEPLKYDWELS
KINGTHAQLSTKHTNFEERVYQVYVKINDGGNPPLENTVSFPVTMCTCVDGRCYQPADTM
PGMPTLGMAIGTLLTTFIVIGVILTVTFICLKKKNNENKANSKLAQSPESDPLRT
Download sequence
Identical sequences F6ZMS8
ENSMODP00000009161 XP_007488177.1.35504 ENSMODP00000009161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]