SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009217 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009217
Domain Number 1 Region: 79-148
Classification Level Classification E-value
Superfamily Translational machinery components 1.72e-19
Family Ribosomal protein L18 and S11 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009217   Gene: ENSMODG00000007428   Transcript: ENSMODT00000009398
Sequence length 170
Comment pep:novel chromosome:BROADO5:2:442189693:442191957:1 gene:ENSMODG00000007428 transcript:ENSMODT00000009398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRARGRDLLALCRNPGFRLAPLTTSPNPAPAPEVDPKENEKIAPEFTNRNPRNLERLA
LARKERGWATVWPSRAYWHRLRVNRTQHHIEAFVEHSSGDVVVSASTREWAIKKHLYRTR
NVNACENIGRVLAQRCLEAGINFMAFYPTPWEESSESACSALRYSDYKMP
Download sequence
Identical sequences F7EDX2
XP_007484913.1.35504 ENSMODP00000009217 ENSMODP00000009217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]