SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009228 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009228
Domain Number 1 Region: 1172-1509
Classification Level Classification E-value
Superfamily NHL repeat 1.33e-24
Family NHL repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 867-942
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000961
Family Pre-dockerin domain 0.057
Further Details:      
 
Domain Number 3 Region: 1479-1656
Classification Level Classification E-value
Superfamily NHL repeat 0.0000178
Family NHL repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009228
Domain Number - Region: 717-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 620-646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 687-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 553-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 743-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 588-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 523-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0712
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009228   Gene: ENSMODG00000007437   Transcript: ENSMODT00000009409
Sequence length 2709
Comment pep:novel chromosome:BROADO5:1:366092693:366610111:1 gene:ENSMODG00000007437 transcript:ENSMODT00000009409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSKRTNVWRDHCHGPLTQRIETFALLYPPGCPLATGMSVFCLSQLSSNLHMSRNIPGPS
LILQQPPSWKRSYLFKLLHSRSSKYTVRSTSKIVLLTQKGPNGMGLFSSPNSRPIPPTSS
SSLLPSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASS
SGPPNHHSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTP
ESVQLQDSWVLNSNVPLETRHFLFKTSSGTTPLFSSSSPGYPLTSGTVYTPPPRLLPRNT
FSRNAFKLKKPSKYCSWKCAALSAIAAAVLLAILLAYFIAMHLLGLNWQLQPADGHTFNN
GIRTGLPGNDDVVTLPSGGKGPWASKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQP
QFLKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQN
EAVFVQYLDVGLWHLAFYNDGKDKEMVSFNTVVLDSVQDCPRNCHGNGECVSGVCHCFPG
FHGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPLSQCIDPSCGGHGSCIEGNC
VCSVGYKGGNCEEVDCLDPTCSTHGVCVNGACLCGPGWGGINCELPRAQCPDQCSGHGTY
LSDTGLCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGTCRCEEGWTGVACDQRVCHPRCTE
HGTCKDGKCECREGWNGEHCTIDGCPDLCNGNGRCTLGQNSWQCVCQTGWRGPGCNVAME
TSCADNKDNEGDGLVDCLDPDCCLQSTCHNSLLCRGSRDPLDIIQQGQTGLPAVKSFYDR
IKLLVGKDSTHIIPGDNPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQD
GTFDLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFV
RPDPIIISSPLSTFFSATPGRNPIVPETQVLHEEIEIPGSTVRLCYLSSRTAGYKSLLKI
TMTQSTVPLNLIKVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVS
VGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHMLNVKSGILHKGTGENQFLT
QQPAIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPS
RNVTSILELRNKEFKHSNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLTGAKDLAGN
SEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGI
ISTLLGSNDLTAVRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQ
VSIIAGRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGILYITETDEKKINRLRQVT
TNGEICLLAGAASDCDCKNDVNCNCYSGDEAYATDAILNSPSSLAVAPDGTIYIADLGNI
RIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTLSLVTGEYLYNFTYNADNDV
TELVDNNGNSLKIRRDNNGLPRHLLMPDNQIITLTVGSNGGLKVVSTQNLELGLMTYDGS
TGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVT
VITNLSSVEASYTVVQDQVRNSYQLCNNGTLRVMYANGMAVSFHSEPHVLAGTITPTIGR
CNISLPMENGLNSIEWRLRKEQIKGKVTVFGRKLRVHGRNLLSIDYDRNIRTEKIYDDHR
KFTLRIIYDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIISRM
FSDGKVWSYSYLDKSMVLLMQSQRQYIFEYDASDRLHAVTMPSVARHSMSTHTSIGYIRN
IYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDET
TGVLKMVNLQSGGFSCTIRYRKIGPLVDKQIYRFSEEGMVNARFDYTYHDNSFRIASIKP
VISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQY
EMFRSLMYWMTVQYDSMGRVTKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYS
YDLNGNLHLLNPGNSVRIIPLRFDLRDRITRLGDIQYKIDDDGFLSQRGSDIFEYNSKGL
LTRAYNKASGWSVQYRYDGVGRRASCKTNLGHHLQYFYSDLHNPTRMTHVYNHSNSEITS
LYYDLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDF
QLVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWRNIGKEPAPFNLYMFKSNNP
LSNELDLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASETGQLITG
VQQTTERHNQAFMALEGQVISKRLHASIREKAGHWFATTTPIIGKGIMFAIKEGRVVTGV
SSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGSSDSDLVTLAMTSGRKVLDS
GVNVTMSQPTLLVNGRTRRFTNIEFQYRTLLLNIRYGLTPDTLDEEKARVLDQARQRALG
AAWAKEQQKAREGREGSRLWTDGEKQQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQF
LRQNEMGKR
Download sequence
Identical sequences F7DWJ4
ENSMODP00000009228 ENSMODP00000009228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]