SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009251 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009251
Domain Number 1 Region: 1410-1617
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-34
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 2 Region: 459-571
Classification Level Classification E-value
Superfamily Cadherin-like 4e-29
Family Cadherin 0.0009
Further Details:      
 
Domain Number 3 Region: 873-978
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-28
Family Cadherin 0.00055
Further Details:      
 
Domain Number 4 Region: 564-667
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-28
Family Cadherin 0.00065
Further Details:      
 
Domain Number 5 Region: 353-457
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-27
Family Cadherin 0.00074
Further Details:      
 
Domain Number 6 Region: 764-871
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 248-351
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 979-1080
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 667-768
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 1672-1827
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-19
Family Laminin G-like module 0.008
Further Details:      
 
Domain Number 11 Region: 1082-1184
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000171
Family Cadherin 0.0089
Further Details:      
 
Domain Number 12 Region: 1350-1389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000726
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1860-1893
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000195
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 1988-2028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 15 Region: 2468-2708
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000787
Family Rhodopsin-like 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009251
Domain Number - Region: 2032-2089
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00017
Family Hormone receptor domain 0.0071
Further Details:      
 
Domain Number - Region: 1897-1934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1330-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00257
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009251   Gene: ENSMODG00000007455   Transcript: ENSMODT00000009432
Sequence length 3017
Comment pep:novel chromosome:BROADO5:8:11666957:11802059:-1 gene:ENSMODG00000007455 transcript:ENSMODT00000009432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRSLLLLGGSALLVPVLLPAAEATAAAARGPWLRALALGPAWRYALNWDRTAPELRPL
LKLSPDGRLRLAGGGPRLWDCELQLHVDIFSRRSPTVLTVALTRRGGSAREPERIPDLAA
RTVLGASPGPASSSSSSSAPLCFPDPGGGGRGSDELQAALEALTSFPDCRLPQPARLPPP
AICLEPGATARLRLLCAPRPVRGPGAWQPGRPLLRRGPEILLELTLETSGTLPSGARRAR
RGASGSTSPQFQLPSYHVSVPENEPAGTPVIELRAQDPDEGEAGRLTYQMEALFDERSIG
FFHIDSDTGAISNSRPLDRETKDTHVLKVTAVDHGSPQRSGATYLTVTVSDTNDHSPVFE
QVEYRETVRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGADGAFKIDPRTGVVRTRSV
VDREEVAEYQLLVEANDQGLNPGPRSATATVRILVEDENDNYPQFSEKRYVVQVPEDVAV
NTAILRVQATDQDQGQNAALHYSIVSGNLKGQFYLHSLSGGLDVINPLDYEAIREYTLRI
KAQDGGRPPLINSSGLVNVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAIDADS
GENARLHYRLVDGGFPFQIHNSSGWITVCAELDREEAEHYSFGVEAVDHGSPAMSSSASV
AITVLDVNDNDPAFTQPVYELRLNEDAAVGSSVLTLRARDRDANSVITYQLSSGNTRNRF
ALSSQSGGGLITLALPLDYKQERQYVLGVTASDGTRSHTAQVFINVTDANTHRPVFQSSH
YTVSVREDKPVGSSIATISATDEDTGENARITYVLEDPVPQFGIHPDTGTLVTLMELDYE
DQAAYTLAITARDNGIPQKSDTTSLEILIVDANDNAPRFLRDLYQGSVFEDAPPSTSVLQ
VSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYSLRALAVDR
GSPAPLSASVDVQVTVLDINDNPPVFEQDELELFVEENSPVGSVVARIRAADPDEGPNAQ
IMYQIVEGNVPEVFQLDLLSGDLRALAELDFERRRDYVLVVQATSAPLVSRATVHVRLLD
QNDNPPVLPDFQVLFNNYVSNKSNSFPAGVIGRIPAHDPDLSDGLNYTFLRGNELNLLLL
NPDTGELQLSRDLDNNRPLEALMEVSVSDGIHHVTALCTLRVTIITDDMLTNSITVRLEN
MSQEKFLSPLLSLFVEGVAAVLSTTTDGIFVFNIQNDTDVSSNILNVTFSALLPGGVRNK
FFPSEDLQEQIYLNRTLLRLISTQRVLPFDDNICLREPCENYMKCVSVLKFDSSAPFISS
TTVLFRPIHPISGLRCRCPPGFTGDYCETEIDLCYSNPCGSNGLCRSREGGYTCDCHEDY
TGEHCEVNARSGRCAPGVCKNGGKCVNLLVGGFKCECLPGEFERPYCAVTTRSFPPQSFV
TFKGLRQRFHFTLSLTFATRDRNALLLYNGRFNEKHDFLALEIIEEQLQLTFSAGETRTT
VAPVVCGGVSDGQWHSVRVQYYNKPHIGRLGIPHGPSGEKVAVVSVDDCDTAVAVRFGGL
LANYSCAAQGTQTGSKKSLDLTGPLLLGGVPNLPEDFPVHNTQFVGCMRNLSIDNQKGWP
APATKNGHEESLNLGFDGSCLWDFTCPSRGQPWTSQGVTTLVSVSFPVMPHPQRFSGESL
VFWGDLDITISVPWYLGLMFRTRKASGVLLAANAGTASKISLQILNSHVYFAVFHGSSEV
ASVRLGRSRVSDGEWHHLLVELKSAKDGKDIKYLAVVTLDYGLDQNTVQIGNQLPGLKMR
SVLVGGLSEDQVTVQQGFSGCMQVVQLVLPRWGETSTNILTLNMKEALTVRVKDGCAMDD
PCASGPCPEHSYCTDTWDGYSCICAPGYFGRDCVDVCRLNPCEHVSACRQPSSAHGYLCE
CGQSYYGQYCENKIHLPCPKGWWGSPVCGPCHCEVSKGFDPDCNKTNGESQSKENYYKPQ
NQAACSPCDCFAHGSHTRTCDMETGQCACKSGVIGRQCNRCDNPFAEVTTQGCEVIYSGC
PRAFEAGIWWPQTKFGQPAAVPCPKGSVGNAIRHCSSEKGWLPPELFNCTTSSFVGLKVM
NEKLHRNETRLDGDKSVQMARVLENATRSVELLYGNDVRTAYQLMLHLLQHESQQQGFDL
AATRDVEFNENLVRTGSALLDPSHRDAWEQIQRTEGGTAHLLRHYEAYFSNLVKNMRRTY
MKPFVIVTANMILAADVFDKANFSGARVPRFEDIYEDYPKELESSVLFPAHLFQPSDRRD
APTAKPSQPRGTPRAPPDGPAPHDPLAKRKRRHPDEWSRHAVGLVLIYRSLGQLLPEQYD
PDRRSLRLPHRPVINSPIVSSLLHSEGDGAPGQPVLVEYTLLETEDRTKPVCVFWNHSLG
SLGAGGWSAKGCELVSRNSSHITCQCSHASGLAVLMDISKREHGEVLPLKIATYAGVAVS
LAALLAALVLLLALRTLRANLHSIHRNLIAALFSSQLVFVTGIDQTETPFTCTVIAILLH
YFYLSTFAWLFVEDLHIYRMLTEVRNIDAGHMRFYYVLGWGIPAIVTGLAVGLDPQGYGN
PDFCWLSIHDTLIWSFAGPIGVVVIINTVIFVLSARVSCRRKHRAYDRTGIISGLRTAFL
LLLLISATWLLGLMAVNSDVMAFHYLFAVFSCLQGVAIFLFHCVFNKEVQKHLKATLMGK
KAHPDDSTTTRATLLTRSLNCNNTYIEEPNMYRTALGESTASLDSTIRSEGTKKLSVSSG
QARGRPDSDAHLFRRRNSKNPRGNDSDSDSELSLEEHSSSYASSHSSDSEEDGVDEKSKW
NPGSCKANDRGPIHSTPKADPLSNHIKATWPPDSMTGSDGEDARCKPKLKVETKVNVELH
QENQENQDDGRDAPSDKENPGLPRDNQMTPHTNHQHPEQRKGILKNKVTYPPPLTERNLK
NRFREKLADYNQTMNSSRTSSLGSNDGICPTVDPGVTVKNSPREHSCDQLNGVVMNVRTG
TVHADASDSEGSNETSI
Download sequence
Identical sequences F7DB32
ENSMODP00000009251 ENSMODP00000009251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]