SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009305 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009305
Domain Number 1 Region: 353-528
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-45
Family SPRY domain 0.00048
Further Details:      
 
Domain Number 2 Region: 106-167
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000336
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009305   Gene: ENSMODG00000007499   Transcript: ENSMODT00000009486
Sequence length 539
Comment pep:novel chromosome:BROADO5:2:262874569:262917778:-1 gene:ENSMODG00000007499 transcript:ENSMODT00000009486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPEMPALRGPKTEKKIHEDKGKTEDPCSSATEPRDSLGETVTGFKKEGRIPEQGAFNSGE
DETTCDFCLEEKVKAVKFCLTCMVNYCEDHVRPHQENSKLYSHQLIKPVRDIELYTCSAH
QGQLAWFCFLEQQCICEECTQEDHRGHPILSLEAMRREKQTELQQAQLDFEKKIKASEND
IVRLQADSKSILVSVSEVKTVAEQQFGNLHEAVRKAQEYVLLFLEKKEQVALSEARSIKK
YLESKHAELENSKHALERMVNITNNVLFLEEYCKIKKNIEYNPFPSVYVGLKEKLSGIQK
VIMDCTEHLLQFLQNYKGKLEEFSKEEEYKISTQVSDVMPHNYWTSIPEPSNRNDFLKYA
YPITFDPDTAHRYLRLQEDNHKVTNTTPWEHPYPDHPSRFEHLRQVLSKQSLYLNQYYFE
LEIKGAGVYIGVTNKSIDRKGSESNSRISGNNFSWSIHWNGKEFSAWHNDSETLLKGGQF
QRLGIYLNYVGSTLSFYGIEFDTMVLIHKFNCDFAEPVYPVFWLSKKENSIQIIELSEK
Download sequence
Identical sequences F6YXA4
13616.ENSMODP00000009305 ENSMODP00000009305 ENSMODP00000009305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]