SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009310 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009310
Domain Number 1 Region: 319-648
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-71
Family Pancreatic carboxypeptidases 0.00000225
Further Details:      
 
Domain Number 2 Region: 140-301
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.32e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00017
Further Details:      
 
Domain Number 3 Region: 648-736
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 5.69e-19
Family Carboxypeptidase regulatory domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009310   Gene: ENSMODG00000007502   Transcript: ENSMODT00000009491
Sequence length 761
Comment pep:novel chromosome:BROADO5:1:83267029:83533058:1 gene:ENSMODG00000007502 transcript:ENSMODT00000009491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRARGAWASPLVVVLWILSLTFIGEGAQGRTLEDQDYYIQEILNRGHYYAFPEPEEETA
TEEPREEMEERGRPEEKRQPPKFKPAKKELKPKKTKKEKLMLETPPGKNGNKKSEKNRSH
DKVSNGDNESQIVSEDVRESCPPLGLETLKITDFQLHASTVKRYGLGAHRGRLNIQAGIN
ENDFYDGAWCAGRNDLHQWIEVDARRLTKFTGVITQGRNSLWLSDWVTSYKVMVSNDSHT
WITVKNGSGDVIFEGNSEKEIPVLNELPVPVVARYIRINPRSWFDNGSICLRLEILGCPL
PDPNNYYHRRNEMTTTDDLDFKHHNYKEMRQLMKIVNEMCPNITRIYNIGKSHQGLKLYA
VEISDNPGEHEVGEPEFRYIAGAHGNEVLGRELMLLLMQFLCQEYRAGNTRIVRLIEDTR
IHLLPSANPDGYEKAYEVGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEAEDRRNFARK
VPNHYIPIPEWFLSENATVAVETRAIIAWMEKIPFVLGGNLQGGELVVAYPYDMVRSLWK
TQEQTPTPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKEDGTVNGASWHTVAGSLN
DFSYLHTNCFELSIYVGCDKYPHESDLPEEWENNRESLIVFMEQVHRGIKGIVRDTHGKG
IPNAIISVEGVNHDIRTANDGDYWRLLNPGEYVVTARAEGFTSSTKNCAVGYDMGATRCD
FTISKTNLARIKEIMEKFGKQPISLPVRRLKLRARQRRQRR
Download sequence
Identical sequences F6YX02
XP_001376150.1.35504 ENSMODP00000009310 ENSMODP00000009310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]