SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009461 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000009461
Domain Number - Region: 26-79
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000188
Family TNF receptor-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009461   Gene: ENSMODG00000007624   Transcript: ENSMODT00000009647
Sequence length 450
Comment pep:novel chromosome:BROADO5:4:345890350:345951710:-1 gene:ENSMODG00000007624 transcript:ENSMODT00000009647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWQRLCWSFTCFLTLLSGHQSFSLSCQDSEYQTEAGGCAACPECPPGEEPNQECGSGPG
LGTVCRACRPGTFSTSLGRSPCLPHTGCAQLRRVEAQVGTTTVDTRCGDCISGFYDPRRH
PDTECWPCSWAPMGTPGCGEPEIGRGGRQRRDVEAGMGPEVHPPENGTQAGVSEEAAAQY
AVIAIVPIFCLMGLLGILLCNLLKKKGYHCTAHKDSGDEAGLEGKNGTNPAYRMDDPNED
TIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSYKPLPKLIQGPPSVPHICHHQHHLH
TVQGLASRSGSCCSRCSQKKWPEVLLSPEAAAATTPTPSALPPRGGSKPVPKGSRPGEIT
ILSVGRFRVARIPEQRPSPPAPEVKTISETSEEGEAAETPPPGLPPENRALLGTGGGRSK
WLKTPASGATESKSEENRYVVRLSESNLVI
Download sequence
Identical sequences F7BLC2
ENSMODP00000009461 ENSMODP00000009461 XP_016277499.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]